KEGG   Streptomyces violaceusniger: Strvi_7108Help
Entry
Strvi_7108        CDS       T01602                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
svl  Streptomyces violaceusniger
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Strvi_7108
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Strvi_7108
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Strvi_7108
Enzymes [BR:svl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Strvi_7108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(8138063..8138881)
Genome map
AA seq 272 aa AA seqDB search
MAGNLELLGSVLAGAKDEGRAALVGYLPAGFPSIDGGVDAMTAMIEGGCDIIEVGLPHSD
PVLDGPVIQTADDIALRGGVKIRDVIRTVGEVHARTGAPILCMTYWNPVDRYGVERFAAD
LAEAGGAGCILPDLPVQESEIWRKAAEQHGLATVFVVAPSSRDERLAKITAAGSGFVYAA
SLMGVTGTRESVGQEARELVERTRGTTTLPVCVGLGVSNATQATEVAAFADGVIVGSAFV
KRLLDAEGDTEAGLAGLRELAGELAEGVRAAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaatctggagctgctgggatccgtcctggcgggcgccaaggacgaggggcgc
gcggcgctcgtcggctatctgcccgccggtttcccctccatcgacggtggggtggacgcg
atgaccgccatgatcgagggcggctgcgacatcatcgaggtcgggctgccgcacagcgat
ccggtcctcgacgggccggtgatccagaccgccgacgacatcgcgctgcgcggcggggtc
aagatccgcgatgtgatccgcacagtgggggaggtgcacgcccggaccggtgccccgatc
ctgtgcatgacgtactggaacccggtggaccggtacggcgtcgagcggttcgccgccgat
ctcgccgaggcgggcggcgcgggctgcatcctgcccgatctgccggtccaggagtcggag
atctggcggaaggccgccgagcagcacggtctggcgaccgtgttcgtggtcgcgcccagc
agccgtgatgagcggctggcgaagatcacggcggcgggcagcggtttcgtctacgcggcg
tccctgatgggcgtcaccggaacgagggaatcggtgggccaggaggcgcgcgagctggtg
gagcgcacccgcggtaccaccacgcttccggtctgcgtggggctcggcgtctccaacgcc
acccaggccaccgaggtcgcggcgttcgccgacggggtcatcgtgggctcggccttcgtc
aagcggctgctggacgccgagggtgacaccgaggccggtctcgcggggctgcgcgagctc
gcgggtgagctggcggaaggcgtgcgcgccgcccgctag

DBGET integrated database retrieval system