KEGG   Streptomyces violaceusniger: Strvi_7109Help
Entry
Strvi_7109        CDS       T01602                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00260  Glycine, serine and threonine metabolism
svl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01130  Biosynthesis of antibiotics
svl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Strvi_7109
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Strvi_7109
Enzymes [BR:svl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Strvi_7109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEM86476
UniProt: G2NW16
Position
complement(8138881..8140128)
Genome map
AA seq 415 aa AA seqDB search
MSSDFFIPDPEGRVPSAEGYFGAFGGKFIPEALVAAVDEVAAEYEKAKTDPAFAAELEDL
LVNYTGRPSALTEVQRFAEHAGGARVFLKREDLNHTGSHKINNVLGQALLTKRMGKSRVI
AETGAGQHGVATATACALFGLECTIYMGEVDTQRQALNVARMRMLGAEVISVTSGSRTLK
DAINEAFRDWVANVDRTHYLFGTVAGPHPFPALVRDFHRVIGVEARRQILERTGRLPDAV
AACVGGGSNAIGLFHAFLPDESVRIVGFEPAGHGVETGEHAATLSQGEPGILHGSRSFVL
QDEDGQITEPYSISAGLDYPGVGPEHAYLKDIGRAEYRAVTDDEAMRALRLLSETEGIIP
AIESAHALAGALDLGRELGSDGLVLVNLSGRGDKDMDTAARYFGLYDQQSDQGAK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgatttcttcattcccgacccggagggtcgagtgcccagcgccgagggctat
ttcggcgccttcggcggcaagttcatccccgaggcgctcgtcgccgcggtcgacgaggtc
gcggccgagtacgagaaggccaagacggaccccgccttcgcggccgagctcgaggatctg
ctggtcaactacaccggccggcccagtgcgctgaccgaggtgcagcggttcgccgagcac
gccgggggcgcccgggtcttcctcaagcgggaggacctcaaccacaccggctcccacaag
atcaacaacgtgctggggcaggccctgctcaccaagcgcatgggcaagtcccgcgtcatc
gccgagaccggcgccggtcagcacggagtggccaccgccaccgcgtgtgcgctgttcggg
ctcgaatgcaccatctacatgggcgaggtcgacacccagcggcaggcgctcaatgtggcg
cggatgcggatgctgggcgccgaggtcatctccgtgacgtccggcagccgcactctcaag
gacgccatcaacgaggcgttccgggactgggtcgccaatgtggaccgcacccactacctc
ttcggcacggtggccggcccgcaccccttcccggcgctggtgcgcgacttccaccgggtg
atcggcgtggaggcgcggcggcagatcctggagcggaccgggcggctgccggacgcggtc
gcggcctgcgtgggcggcggatccaacgcgatcgggctgttccacgccttcctgccggac
gagagcgtgcgcatcgtcggcttcgagcccgccgggcacggtgtggagaccggggagcac
gcggccacgctgagccagggcgagcccgggatcctgcatggctcccggtcgttcgtgctg
caggacgaggacggccagatcaccgagccgtactcgatctcggccggtctggactacccc
ggcgtcgggccggagcacgcgtatctgaaggacatcggccgcgccgagtaccgggcggtc
accgacgacgaggcgatgcgggcgctgcggctgctctcggagaccgagggcatcatcccg
gcgatcgagagcgcccacgcgctggcgggcgccctggacctcggccgtgagctggggagc
gacggcctggtgctggtcaacctctccgggcgcggcgacaaggacatggacacggcggct
cggtacttcgggctctacgaccagcagagcgaccagggagcgaagtga

DBGET integrated database retrieval system