KEGG   Streptomyces violaceusniger: Strvi_7207Help
Entry
Strvi_7207        CDS       T01602                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
svl  Streptomyces violaceusniger
Brite
Enzymes [BR:svl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Strvi_7207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8242342..8243163
Genome map
AA seq 273 aa AA seqDB search
MPLLPGAEPFRHDGGEIGVLVCHGFTGSPQSVRPWADHLAARGLTVSLPLLPGHGTRWQD
LAVTGWQDWYAEVDRELRSLIRRCERVFVCGLSMGGALALRLAAQHGAAISGLALVNPAN
RIHDPLAVALPVLRHLVPSVKGIASDIAKPGAQESGYDRMPLHAVHSMRRLYRVVDAELP
QVTQPLLVMHSPQDHVVPPADSERILSQVSSRDVTERLLERSFHVATLDHDAEFIFEETD
TFITRLTAGMGEDTDTRTDLGKGSGKEGAAASG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctcctgcccggagccgagccgttccgccatgacggcggagagatcggcgtcctc
gtctgtcacggcttcaccggttccccgcagtccgtgcggccctgggccgaccatctcgcg
gcccgtggtctgaccgtctcactgccgctgcttcccggccatggcacccgctggcaggac
ctcgcggtcaccggctggcaggactggtacgcggaggtggaccgcgagctgcggtcgctg
atccggcgctgcgagcgggtgttcgtctgcggtctgtcgatgggcggggcactcgcgctg
cggctggccgcccagcacggcgcggccatcagcggcctcgccctcgtgaatccggccaac
cgcatccacgatccgctggccgtggcccttccggtgctgcgtcatctggtgccttcggtg
aagggcatcgcgagcgatatcgccaagccgggggcgcaggagtcgggctacgaccggatg
ccgctgcacgccgtgcactcgatgcgccgcctctaccgggtggtcgacgccgaactgccg
caggtgacccagccgctgctggtcatgcacagcccccaggaccatgtggtgccgccggcc
gactccgagcgcatcctgagtcaggtgtcctcgcgggacgtcaccgagcggctgctggag
cgcagcttccatgtggcgaccctggaccatgacgccgagttcatcttcgaggagacggac
acgttcatcacccggctgacggcgggtatgggtgaagacaccgacacccggaccgacctc
gggaagggaagcgggaaggagggggcggcggccagtggctga

DBGET integrated database retrieval system