KEGG   Streptomyces violaceusniger: Strvi_7210Help
Entry
Strvi_7210        CDS       T01602                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
svl  Streptomyces violaceusniger
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Strvi_7210
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_7210
   00052 Galactose metabolism
    Strvi_7210
   00500 Starch and sucrose metabolism
    Strvi_7210
   00520 Amino sugar and nucleotide sugar metabolism
    Strvi_7210
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Strvi_7210
   00524 Butirosin and neomycin biosynthesis
    Strvi_7210
Enzymes [BR:svl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Strvi_7210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8244743..8245684)
Genome map
AA seq 313 aa AA seqDB search
MGLTIGVDIGGTKIAAGVVDEEGSILETSQVSTPQTPEGVVDAIADAVRIVSEGHEIEAV
GIGAAGYVDDKRATVLFAPNINWRHEALKDKVEQRVGLPVVVENDANAAAWGEYRFGAGV
GHDDVVCITLGTGLGGGIIIGGKLHRGRFGVAAEFGHIRVVPDGLLCGCGSQGCWEQYAS
GRALVRYARQRAAATPENATVLLGLGDGTAEGVEGKHISDAARQGDPVAIDSFRELARWA
GAGLADLASLFDPSAFIVGGGVSDEGDLVLEPIRKSFRRWLVGNQWRPHAQVLAAQLGGK
AGLVGAADLARQG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgggactcaccatcggcgtcgacatcggcggtacgaagatcgcggccggcgtggtcgac
gaagagggctcgattctcgagacgagccaggtttcgaccccgcagactcccgagggagtc
gtcgacgccatcgcggacgcggtgcgcatcgtcagcgagggacacgagatcgaggccgtc
ggcatcggcgcggccgggtatgtggacgacaagcgcgccaccgtgctcttcgcgcccaac
atcaactggcggcacgaggcgctcaaggacaaggtcgagcagcgcgtcggcctgcccgtc
gtggtggagaacgacgccaatgccgccgcctggggcgaataccgcttcggcgccggggtc
ggccatgacgacgtcgtatgcatcaccctcggcaccggcctcgggggcggcatcatcatc
ggcggcaagctgcaccgcggccgcttcggcgtcgcggccgagttcggccacataagggtc
gtccccgacggtctgctgtgcggctgcggcagtcagggctgctgggagcagtacgcctcc
ggccgtgcgctggtccgctacgccaggcagcgcgccgccgccaccccggagaacgccacg
gtcctcctcggcctcggcgacggcaccgccgagggcgtcgagggcaagcacatcagcgac
gccgcccgccagggcgacccggtggccatcgactccttccgtgagctggcccgctgggcc
ggggccgggctggccgacctcgcctcgctcttcgacccctcggccttcatcgtcggcggc
ggggtctccgacgagggcgatctggtcctggagccgatccgcaagtccttccggcgctgg
ctggtcggcaatcagtggcgtccgcacgcccaggtgctcgccgcccagctcggcggcaag
gccgggctcgtcggcgccgccgacctggcccgccaaggctga

DBGET integrated database retrieval system