KEGG   Streptomyces violaceusniger: Strvi_7258Help
Entry
Strvi_7258        CDS       T01602                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
svl  Streptomyces violaceusniger
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Strvi_7258
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Strvi_7258
  Amino acid metabolism
   00310 Lysine degradation
    Strvi_7258
Enzymes [BR:svl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Strvi_7258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8297510..8299255
Genome map
AA seq 581 aa AA seqDB search
MAVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPAPSAGVLTSIK
VAEDETVEVGAELAVIDDGGAAPAEAPAPAAEPAPAAQPEPAPAPAAEAPAPAAAAPAGG
AQGTDVVLPALGESVTEGTVTRWLKEVGESVEADEPLLEVSTDKVDTEIPAPVAGTLLEI
LVGEDETAEVGAKLAVIGVAGAAPAAAPAPAAPAPAPVQEAPAPAPAPQAPSAPAPQAVT
PEPVAPEPAPAAPAPAPAPAATAPSIPAPAAPEAEGAYVTPLVRKLAAENNVDLSTVKGT
GVGGRVRKQDVIAAAEAAKAAAQAQAAPAAAAPKAAPQAASPLRGQTVKMPRMRKVIGDN
MMRALHEQAQLTSVVEVDVTKVMRLRAQAKEAFAQREGVKLSPMPFFVKAAVQALKAHPA
VNARINDDGTITYFDVENVGIAVDAEKGLMTPVIKNAGDLNIAGIARKTAELAGKVRSSK
ITPDEVSGATFTISNTGSRGALFDTIIVPPNQVAILGIGATVKRPVVIDHPELGETIAVR
NMTYLALSYDHRLVDGADAARYLTAVKEILETGEFEVDLGL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttccgtaaccctgccggcgctcggcgagagcgtgaccgagggcaccgtcacc
cgctggctcaaggccgaaggtgagcgcgtcgaggccgacgagcccctgctcgaggtgtcg
accgacaaggtcgacaccgagatcccggccccttcggccggtgtgctgacgtccatcaag
gtggccgaggacgagacggtcgaggtcggcgccgagctggccgttatcgacgacggcggc
gcggctccggccgaggcccccgcccccgcggccgagcccgctccggcggctcagcccgag
cccgccccggcgcccgccgccgaggcccctgcccctgccgccgccgctccggccggtggc
gcccagggcaccgatgtggtcctgcccgcgctgggcgagtcggtgaccgagggcaccgtg
acccgctggctcaaggaggtcggcgagtccgtcgaggccgatgagccgctgctcgaggtc
tccaccgacaaggtcgacaccgagatcccggccccggtcgcgggcaccctgctggagatc
ctggtcggcgaggacgagaccgccgaggtcggcgccaagctggccgtgatcggtgtcgcc
ggtgccgctccggccgccgcgcccgccccggccgccccggcccccgcaccggtccaggag
gccccggcgcccgccccggccccgcaggccccgagcgcccccgcgccgcaggccgtcacc
ccggagccggtcgcccccgagccggccccggccgctccggcgcccgccccggccccggcc
gcgacagccccgtcgatccctgctcccgcggcccccgaggccgagggcgcctacgtcacc
ccgctggtgcgcaagctggccgccgagaacaacgtggacctgtccaccgtcaagggcacc
ggcgtcggtggccgcgtccgcaagcaggacgtcatcgccgccgccgaggccgccaaggcc
gccgcccaggcccaggccgccccggccgccgccgcgccgaaggccgccccccaggcggcg
tccccgctgcgtggccagaccgtcaagatgccgcggatgcgcaaggtcatcggcgacaac
atgatgcgggccctgcacgagcaggcgcagctcaccagcgtggtcgaggtggatgtcacc
aaggtcatgcggctgcgcgcgcaggccaaggaggcgttcgcgcagcgcgagggcgtcaag
ctctcgccgatgccgttcttcgtgaaggccgccgtccaggcgctgaaggcccacccggcc
gtcaacgcccggatcaacgacgacggcaccatcacgtacttcgacgtggagaacgtcggg
atcgcggtggacgccgagaagggcctgatgaccccggtcatcaagaacgcgggcgacctc
aacatcgccggtatcgccaggaagacggcggagctggccggcaaggtccgctccagcaag
atcaccccggacgaggtgtccggcgccaccttcacgatcagcaacaccggctcgcgcggt
gcgctgttcgacacgatcatcgtgcccccgaaccaggtcgccatcctgggcatcggcgcg
accgtcaagcgcccggtggtcatcgaccacccggagctgggcgagaccatcgcggtgcgc
aacatgacgtacctggcgctctcctacgaccaccgcctggtggacggtgccgacgcggcc
cgctacctgacggccgtcaaggagatcctggagaccggtgagttcgaggtggacctcggt
ctctga

DBGET integrated database retrieval system