KEGG   Streptomyces violaceusniger: Strvi_7313Help
Entry
Strvi_7313        CDS       T01602                                 

Definition
pyridoxal-5'-phosphate-dependent protein beta subunit
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
svl  Streptomyces violaceusniger
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Strvi_7313
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Strvi_7313
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Strvi_7313
Enzymes [BR:svl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Strvi_7313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8360364..8361665
Genome map
AA seq 433 aa AA seqDB search
MKRTGSRWCLNGCSPTLERLSHHTRDRLEPPATPLTRHTQLNKISKVRAEPRAEPRYVDE
RSGATYSIDDPRWCGDDGAPLTVSALPGITREQVDTGARSLWRYRAALPVRIDAPVSLGE
GCTPLVEKDWGEDRILFKLEWFSPTGSFKDRGTSVMISLLAQRGVREVIEDSSGNGGASV
SAYCAAAGIRARILAPATTSPAKILQSRAYGAEVELVPGDRDATAAEALRQSAHTYYASH
NWHPFFLQGTKTLAYELWEDLGFTAPDAVVTVAGAGSTVLGCDLGFSELLAAGQIAHRPR
LLVAQPAHCAPLHAAFHAGTEAPVPFDHAPTIAEGTAIREPVRFPEVLRAIRRSDGDMAA
IPEDAIAAAVRRLTAMGLYAEPTSATAAAAIEVFRARGAIRPGETTVVLLTGSGLKATPT
MTELFAPEGGGPR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggacggggtcgcggtggtgcttgaacggctgttcgcccacccttgagcggctc
tcgcatcacactcgcgaccggttggagccgcccgccacgcccttgactagacatacacaa
ctaaacaaaatatccaaggtgcgagctgaaccacgagctgaaccccgctacgtcgacgag
cgctccggagccacgtactccatcgacgacccccgctggtgcggtgacgacggggctccc
ctcaccgtctccgcgctgcccggcatcacccgcgagcaggtggacaccggggcccggtca
ctctggcgctaccgagcggccctcccggtgcgcatcgacgccccggtgtcactgggtgaa
gggtgcaccccgctggtcgagaaagactggggggaggatcggattctcttcaagctggag
tggttcagccccaccggcagcttcaaggaccgcggcaccagcgtgatgatctcgctcctc
gcccagcggggcgtacgggaggtcatcgaggacagctccggcaacggcggggcctccgtc
tcggcgtactgcgccgcggccggcatccgggccaggatcctcgcccccgccaccacctcc
cccgcgaagatcctccagagccgggcgtacggcgccgaggtcgagctggtgcccggcgac
cgggacgccacggcggcggaggcgctgcgccagtcggcccatacgtactacgccagccac
aactggcaccccttcttcctccagggcaccaagaccctggcgtacgagctgtgggaggac
ctgggcttcaccgcgccggacgccgtggtgaccgtggcgggcgcgggcagcaccgtgctc
ggctgcgacctcggcttctccgagctgctcgccgcgggccagatcgcccaccgcccccgg
ctgctcgtggcccagcccgcccactgcgcaccgctccacgccgcgttccacgcgggcacg
gaggccccggtgccgttcgaccacgccccgaccatcgccgagggcacggccatccgggag
cccgtccgcttcccggaggtgctgcgcgccatccgccgctcggacggcgacatggcggcc
atcccggaggacgcgatcgccgcggcggtccgccggctgaccgcgatggggctgtacgcg
gagccgaccagcgcgacggccgcagcggcgatcgaggtcttccgggcccggggcgcgatc
cgccccggtgagacgacggtggtgctgctgaccgggtcgggcctgaaggcgacgccgacg
atgacggagctcttcgcaccggagggcggtgggccgcgttga

DBGET integrated database retrieval system