KEGG   Streptomyces violaceusniger: Strvi_7313Help
Entry
Strvi_7313        CDS       T01602                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
svl  Streptomyces violaceusniger
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Strvi_7313
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Strvi_7313
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Strvi_7313
Enzymes [BR:svl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Strvi_7313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8360364..8361665
Genome map
AA seq 433 aa AA seqDB search
MKRTGSRWCLNGCSPTLERLSHHTRDRLEPPATPLTRHTQLNKISKVRAEPRAEPRYVDE
RSGATYSIDDPRWCGDDGAPLTVSALPGITREQVDTGARSLWRYRAALPVRIDAPVSLGE
GCTPLVEKDWGEDRILFKLEWFSPTGSFKDRGTSVMISLLAQRGVREVIEDSSGNGGASV
SAYCAAAGIRARILAPATTSPAKILQSRAYGAEVELVPGDRDATAAEALRQSAHTYYASH
NWHPFFLQGTKTLAYELWEDLGFTAPDAVVTVAGAGSTVLGCDLGFSELLAAGQIAHRPR
LLVAQPAHCAPLHAAFHAGTEAPVPFDHAPTIAEGTAIREPVRFPEVLRAIRRSDGDMAA
IPEDAIAAAVRRLTAMGLYAEPTSATAAAAIEVFRARGAIRPGETTVVLLTGSGLKATPT
MTELFAPEGGGPR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggacggggtcgcggtggtgcttgaacggctgttcgcccacccttgagcggctc
tcgcatcacactcgcgaccggttggagccgcccgccacgcccttgactagacatacacaa
ctaaacaaaatatccaaggtgcgagctgaaccacgagctgaaccccgctacgtcgacgag
cgctccggagccacgtactccatcgacgacccccgctggtgcggtgacgacggggctccc
ctcaccgtctccgcgctgcccggcatcacccgcgagcaggtggacaccggggcccggtca
ctctggcgctaccgagcggccctcccggtgcgcatcgacgccccggtgtcactgggtgaa
gggtgcaccccgctggtcgagaaagactggggggaggatcggattctcttcaagctggag
tggttcagccccaccggcagcttcaaggaccgcggcaccagcgtgatgatctcgctcctc
gcccagcggggcgtacgggaggtcatcgaggacagctccggcaacggcggggcctccgtc
tcggcgtactgcgccgcggccggcatccgggccaggatcctcgcccccgccaccacctcc
cccgcgaagatcctccagagccgggcgtacggcgccgaggtcgagctggtgcccggcgac
cgggacgccacggcggcggaggcgctgcgccagtcggcccatacgtactacgccagccac
aactggcaccccttcttcctccagggcaccaagaccctggcgtacgagctgtgggaggac
ctgggcttcaccgcgccggacgccgtggtgaccgtggcgggcgcgggcagcaccgtgctc
ggctgcgacctcggcttctccgagctgctcgccgcgggccagatcgcccaccgcccccgg
ctgctcgtggcccagcccgcccactgcgcaccgctccacgccgcgttccacgcgggcacg
gaggccccggtgccgttcgaccacgccccgaccatcgccgagggcacggccatccgggag
cccgtccgcttcccggaggtgctgcgcgccatccgccgctcggacggcgacatggcggcc
atcccggaggacgcgatcgccgcggcggtccgccggctgaccgcgatggggctgtacgcg
gagccgaccagcgcgacggccgcagcggcgatcgaggtcttccgggcccggggcgcgatc
cgccccggtgagacgacggtggtgctgctgaccgggtcgggcctgaaggcgacgccgacg
atgacggagctcttcgcaccggagggcggtgggccgcgttga

DBGET integrated database retrieval system