KEGG   Streptomyces violaceusniger: Strvi_7559Help
Entry
Strvi_7559        CDS       T01602                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
svl  Streptomyces violaceusniger
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_7559
   00052 Galactose metabolism
    Strvi_7559
Enzymes [BR:svl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Strvi_7559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8620772..8621965
Genome map
AA seq 397 aa AA seqDB search
MTTSRRTVITAAAAAGLAASAATTGTAHAKSGGDSAGSGGDSAGKGGAVKEHFGTLADGT
DVDRWTIENGRTRLRVLSYGGIVQSLEIPDRHGRRANVSLGFDDLDSYVANSPYFGALIG
RYGNRIARGTFTLDGKKYQLPINDGPNSLHGGDKGFDKHVWSVEAFRKGADVGLTLRRVS
PDGEMGYPGTLTVRVDYTLTAEGDFRIDYEATTDKATVVNLTNHTYYNLAGEGSGSIYNH
RLEIAAARYTPVDKTLIPTGELARVAGTPFDFRRTKEIGRDIREAHQQVLYGQGIDHNFV
LDKGITSRPEHFLTVTEPESGRVMRIATTEPGAQFYTGNFLTGTFAGTSGKVYRQGDAFA
LETQHFPDSPNQPSFPSTVLRPGQTYRSTTVHSFSTR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgagcagacgcacggtgatcacggctgcggcggcggccggactggcggcatcg
gccgccacgaccggcaccgcccacgcgaagagcggaggagactccgcgggcagcggggga
gactccgcgggcaagggaggcgcggtgaaggaacacttcggcacgctcgcggacggcacg
gacgtcgaccgctggacgatcgagaacggccgcacccggctgcgcgtgctcagctacggc
ggcatcgtccagagcctggagatccccgaccggcacggccgccgcgccaatgtgtcgctc
ggcttcgacgacctggactcctacgtcgccaacagcccgtacttcggcgccctcatcggc
cgctacggcaaccgcatcgcccgcggcacgttcacgctggacggcaagaagtaccagctc
ccgatcaacgacgggccgaacagcctgcacggcggcgacaagggattcgacaagcacgtc
tggtccgtggaggcgttccgcaagggcgcggacgtggggctcaccctgcgccgggtcagc
cccgacggcgagatgggctaccccggcaccctcaccgtgcgcgtggactacacgctcacg
gcggagggcgacttccgcatcgactacgaggccacgaccgacaaggccacggtcgtgaac
ctcaccaaccacacgtactacaacctggccggggagggcagcggctccatctacaaccac
cggctggagatcgccgccgcccgctacaccccggtcgacaagaccctcatccccaccggc
gagctcgccagggtggccgggaccccgttcgacttccgccgcaccaaggagatcggccgg
gacatccgggaggcgcaccagcaggtgctgtacgggcaggggatcgaccacaacttcgtg
ctggacaagggcatcaccagccgtcccgagcacttcctgacggtgaccgagccggagtcc
ggccgggtgatgcggatcgcgacgaccgagcccggtgcgcagttctacaccggcaacttc
ctgaccggcacgttcgcgggcacgtcggggaaggtctaccggcagggcgacgccttcgcc
ctggagacccagcacttcccggactcgccgaaccagccgtcgttcccgtcgacggtgctg
cggccggggcagacgtaccggtcgacgaccgtgcactcgttctcgacgcgctga

DBGET integrated database retrieval system