KEGG   Streptomyces violaceusniger: Strvi_7939Help
Entry
Strvi_7939        CDS       T01602                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
svl  Streptomyces violaceusniger
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:svl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9015853..9018069)
Genome map
AA seq 738 aa AA seqDB search
MGRARLAELHGVATSYEPAPGRTVQVPEDTVVAVLAALGVDASTPESVREALDRHERRQR
DQLLPPCVVVRPGKAPRLSLPEGTALRVRPEDGAPHTRGRAAAGTRRADGPLTEVRTDSA
HTGGVLTGGAHAGGVLTEGTTAGGLLTALAALPPGAHTLLAEAPDGRRATAPLIVAPDRM
PLSPVRSHGFLVQLYSLLSARSWGMGDLGDLADLAAWSGRALGAGFVQINPLHAAVPGTP
GAPTDPSPYRPSSRRFPDPVHLRIEDVPEYVQLRGPARERADQLLEAAAALRTSVLREGA
LIDRDAVLALKREALELVRTVPLSPGRRAAYCDFLAERGQALEDHALWCALAETHGPEWR
TWPGGLADPRSAGTARARAEHLDRTDFHCWLAWLTDTQLAAAQHAARDAGMGIGLVHDLA
VGVHPSGADAWALQDVFASGMSIGAPPDAFNSRGQDWGLPPWRPDALAATGYAPYRDLLR
GLLRHAGALRIDHVMGLFRLWWVPEGREPTEGCYVRYDAEAMLGVLALEAHRAGTVVIGE
DLGTVEPGVREELERRGVLGTSVMWFERNYNGAGAARPLSPGEWRADCLATVTTHDLPST
AARLTGDHVELRHRLGLLTRPLAEERATDAVEVAEWLALLGRLGLLPEGPGDEEGAVKAV
HRFLLRTPARMVGVWLPDAVGDRRPQNLPGTWDQYPNWRLPIADAEGRPMSLEELVASPR
LRALMDEVARLAPRGLAP
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgggcagagcgcggctcgccgagctgcacggtgtcgccacctcctacgagcccgccccg
ggccgcaccgtccaggtgcccgaggacacagtcgtcgccgtactggccgcgctcggcgtg
gacgcctcgacccccgaatcggtacgcgaagcgctggaccggcatgagcgccggcagcgc
gaccaactgctgcccccctgcgtggtggtgcgccccggcaaggcgccacgcctgagcctg
cccgagggcacggcgctgcgggtgcgccccgaagacggcgcaccgcacacgcgggggcgg
gcggccgcggggacccggagggccgatggcccccttacggaggtccgcacagacagcgcc
cataccggcggcgttcttacgggcggcgctcatgcgggtggcgttcttacggagggcacc
accgccggcggcctccttaccgcgctcgccgcgctgccgcccggcgcccacaccctgctc
gccgaggcccccgacggccgccgcgccaccgcccccctcatcgtggcccccgaccggatg
ccgttatccccggtccgcagccacggctttctggtgcagctctactcgctgctctccgca
cgctcctggggcatgggcgacctcggcgacctggccgatctggccgcctggtcggggcgg
gcgctcggcgccggcttcgtccagatcaacccgctgcacgccgccgtgcccggcaccccg
ggcgcgcccaccgacccctcgccctaccgcccctcctcgcgccgcttccccgacccggtc
catctgcggatcgaggacgtgcccgaatacgtccagttgcgcggccccgcccgcgagcgg
gccgatcagctcctggaggccgccgccgccctccgtacgtccgtcctgcgcgagggcgcc
ctgatcgaccgggacgccgtcttggccctcaagcgcgaggcgctggagctggtgcggacg
gtccccctcagccccggccgccgcgccgcctactgcgacttcctcgccgagcgcggtcag
gccctggaggaccatgccctgtggtgcgcgctcgccgagacccacggccccgaatggcgc
acctggcccggtgggctggccgatccgcgctcggcgggcaccgcccgggcgcgggccgag
catctggaccgcaccgacttccactgctggctggcctggctcaccgacacccagctcgcc
gccgcccagcacgccgcgcgcgacgcgggcatgggcatcggcctcgtgcacgatctggcg
gtcggggtccatccctcgggcgccgacgcctgggcgctccaggacgtcttcgcctccggc
atgtcgatcggcgcgcccccggacgccttcaactcccggggtcaggactggggcctgccg
ccgtggcgcccggacgcgctcgccgccaccggctacgccccgtaccgcgatctgctgcgc
ggcctcttacggcacgcgggcgcgctccgcatcgaccatgtgatgggcctcttccggctg
tggtgggtccccgaggggcgtgagccgaccgagggctgttacgtccgctacgacgcggag
gcgatgctcggcgtgctcgccctggaggcgcaccgggccgggacggtcgtcataggggag
gacctggggacggtcgagcccggcgtgcgggaggagctggagcggcgcggggtgctgggg
acgtcggtgatgtggttcgagcggaattacaacggggcgggcgcggcccggccgctgtcc
cccggggagtggcgcgcggactgcctggccaccgtgacgacccacgatctgccgagcacg
gccgcccggctcaccggcgaccatgtcgagctccggcaccggctgggcctgctgacccgg
cccctcgccgaggagcgcgcgacggacgcggtcgaggtcgccgagtggctggcgctgctg
gggcggctcgggctgctgccggagggcccgggcgacgaggagggggcggtcaaggcggtc
caccgctttctgctgcgcaccccggcgagaatggtgggcgtatggctgccggacgccgtg
ggggaccgcagaccgcagaatctgccgggcacctgggatcagtaccccaactggcggctg
ccgatcgccgacgccgaggggcgcccgatgtccctggaggagctggtcgcctcgccccgg
ctgcgggcgctgatggacgaggtggcccggctcgcccctcgtggccttgccccgtaa

DBGET integrated database retrieval system