KEGG   Streptomyces violaceusniger: Strvi_7974Help
Entry
Strvi_7974        CDS       T01602                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
svl  Streptomyces violaceusniger
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Strvi_7974
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_7974
  Lipid metabolism
   00071 Fatty acid degradation
    Strvi_7974
  Amino acid metabolism
   00350 Tyrosine metabolism
    Strvi_7974
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Strvi_7974
   00626 Naphthalene degradation
    Strvi_7974
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Strvi_7974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9063153..9064178)
Genome map
AA seq 341 aa AA seqDB search
MTTDANADLPATMRAWVVPAPGRIEQVELPVPRPAEDELLIRVRACGVCRTDLHVRDGDL
PPHRSPVVPGHEAVGEVVAAGSRAHGPGPGVRLGVPWLRRTCGHCRYCLRGQENLCPSSE
YTGWDADGGYAEYVTVPAAYAYELPSGYTDEELAPLLCAGIIGYRALRRADLPPGGRLGI
YGFGGSAHLTAQVAIDQGAVVHVLTRSPAAQTLALELGAASANDSYDRPPEPLDAAILFA
PVGQLVPVALEALDAGGTLSIAGIYLSDIPSLDYDRHLFRERTMRSVTANTREDGREFLA
AAAEDRISATVTPYPFDRADAALDDLAADRVNGVAVLTMPQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacggacgcgaacgccgacctcccggcgaccatgcgggcatgggtggtccccgcc
ccgggccggatcgagcaggtggagctgccggtgccacgaccggcggaggacgaactgctg
atccgggtccgggcctgcggggtgtgccgcaccgatctgcacgtccgcgacggcgatctg
cccccgcaccgcagccccgtcgtccccggccacgaggccgtcggcgaggtcgtcgcggcg
ggctcgcgggcgcacggccccggccccggagtccggctcggcgtcccctggctgcggcgc
acctgcggccactgccgctactgcctccggggccaggagaacctgtgcccgtcctcggag
tacaccggctgggacgcggacggcggctacgccgagtacgtcaccgtaccggcggcctac
gcctatgagctgccctccggatacaccgacgaggagctcgccccgctgctgtgcgccggc
atcatcggctaccgcgccctgcgccgggccgacctgccgccgggcggccggctcggcatc
tacggcttcggcggctccgcccacctcaccgcccaggtggccatcgaccagggcgccgtc
gtccacgtcctgacccgctcacccgccgcccagaccctcgccctggaactcggtgccgcc
tccgcgaacgactcctacgaccgcccgcccgagcccctcgacgccgccatcctcttcgcc
ccggtcggccaactggtcccggtcgccctggaggccctggacgccggcggcacgctgagc
atcgccgggatctacctctcggacatcccgtccctcgactacgaccgccatctcttccgc
gaacgcaccatgcgcagcgtcaccgccaacacccgcgaggacgggcgcgaattccttgcc
gcggccgccgaggaccgcatcagcgccacggtcacgccctaccccttcgaccgggcggac
gccgccctcgacgacctcgccgccgaccgcgtcaacggggtggcggtcctgacgatgccg
cagtag

DBGET integrated database retrieval system