KEGG   Streptomyces violaceusniger: Strvi_8034Help
Entry
Strvi_8034        CDS       T01602                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
svl  Streptomyces violaceusniger
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Strvi_8034
Enzymes [BR:svl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Strvi_8034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9270182..9271108
Genome map
AA seq 308 aa AA seqDB search
MHDYDLLVVGSANADLVIGVDRRPGAGETVLGSDLAVHPGGKGANQAVAAARLGARTALL
ARVGDDDYGRLLLDSQAKAGVDTVGVLVGGAPTGVALITVDPSGDNSIVVSQGANARLTP
GDVRAAASLLAAARVVSLQLEIPLETVAEVVRAAGAGFGGRPGPRVVLNPSPTAPLPTDV
LAACDPLVVNEHEARFLLSDAPVGSSDDPEEWADALLSRGPRSVVVTLGAEGALVADGDR
TVLVPSPAVTAVDTTGAGDAFTGALAWRLGVGDDLPTAVRFAVRVGAAAVTRAGAQASFP
SAEEVAAL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcacgactacgacctgctggtcgtggggtcggccaacgccgatctggtgatcggagtc
gaccgccgccccggggccggcgagaccgtcctcgggtccgacctcgcggtccacccgggc
ggcaagggggccaaccaggccgtcgccgccgcccggctgggggcccggacggcgctgctg
gcccgggtcggcgacgacgactacggccggctgctgctggattcgcaagcgaaggccggg
gtcgacaccgtcggcgtcctcgtcggcggcgcgcccaccggggtcgcgctgatcacggtg
gacccctcgggtgacaacagcatcgtggtctcccagggggccaacgcccggctgaccccc
ggcgacgtccgggccgcggcgagcctgctggccgcggcgcgggtggtctcgctgcaactg
gagatccccctggagacggtcgccgaggtggtccgcgcggcgggcgcgggcttcggcggc
cgccccgggccgcgggtggtgctcaacccctcgccgaccgcgccgctgcccaccgatgtg
ctggccgcctgcgatccgctggtggtcaacgagcacgaggcgcggttcctgctgagcgac
gccccggtggggtcctccgacgaccccgaggagtgggccgacgccctgctgtcgcgcggt
ccgcgctcggtcgtggtgaccctgggcgccgagggcgcgctggtcgccgacggcgaccgc
acggtgctggtgcccagtcccgcggtgacggccgtggacaccacgggcgccggggacgcc
ttcaccggcgcgctcgcctggcgcctcggcgtcggcgacgacctgccgacggcggtgcgg
ttcgcggtgcgcgtgggcgccgccgcggtgacacgggccggggcgcaggcgtccttcccg
agcgccgaggaggtggcggcgctgtga

DBGET integrated database retrieval system