KEGG   Streptomyces violaceusniger: Strvi_8071Help
Entry
Strvi_8071        CDS       T01602                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
svl  Streptomyces violaceusniger
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Strvi_8071
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Strvi_8071
Enzymes [BR:svl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Strvi_8071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9312908..9314830
Genome map
AA seq 640 aa AA seqDB search
MHTTTSRRALLTATLAAAAAGACSAPTNSSPAPAAPARRTTAGSGGPSATPSRATAQPGR
DQERDRRRIDELIGRMTLDQKIGQLFVMRVYGHSATHPDPADVAANVKDIGVDNAAELIA
KYHVGGVMYIRWAHNIRDPHQVAALSNGIQKAALAASVPVPVLLSTDQEYGTVARVGAPA
TLFPGAMALGAGGSAADARTAARTAGAELAALGIRQDYAPIADVNVNPANPVIGVRSFGA
DPKAVARLVAAQVEGYQSAGVAATAKHFPGHGDTSVDSHVGLPRITHSRKEWERLDAPPF
RAAIAAGIDSIMTAHLLFPALDPADDPATLSRPILTGVLREELGYDGVVVTDSLGMQGVR
EKYGDDRVPVLALKAGVDQLLNPPSLSRAFEGVRKAVRAGELDEDRIDRSLRRILELKVR
RGLFDDPYTSDRAVNRTVGTREHRATADRIAERTTTLITNRGGLLPLSPRRRHDLLVVGV
DAAAPSGTGGPPTAVLARALSGLGFKAEALPTGTGDSPGPSPERIEAAVAAARGRDAVIV
ATYDIAAGSAQRTLVARLVATGVPVVHLALRDPYDIARLGGRGTEPGASLATYCWTDVEL
RAAARVIAGRVTPRGKLPVAVRRADDPSRELYPIGHGLGY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
gtgcacacgacgacgtctcgccgcgccctgctcaccgccactctggccgccgccgcggcc
ggtgcctgcagtgcgccgacgaacagctccccagcgcccgcggcccccgcacgccgcacc
accgccggttccggcggcccttccgcgacgccctcacgagccaccgcacagcccggccgg
gaccaggagcgcgaccgccggcggatcgacgagctcatcggccggatgacgctggaccag
aagatcggccagctcttcgtgatgcgggtgtacggccattcggccacccaccccgacccc
gccgatgtagcggccaacgtcaaggacatcggcgtcgacaacgccgccgagctgatcgcg
aagtaccacgtgggcggggtgatgtacatccgctgggcgcacaacatccgcgacccccac
caggtcgccgcgctctccaacggcatccagaaggccgcgctggcggcctccgtgcccgtc
cccgtcctgctctccaccgaccaggagtacggcaccgtcgcccgggtcggcgcgcccgcc
acgctgttcccgggcgccatggcgctcggcgcgggcggcagcgcggccgacgcccgtacg
gccgcccgcaccgcgggggcggagctggccgcgctcggcatccggcaggactacgccccg
atcgcggacgtcaacgtcaacccagccaatccggtgatcggcgtgcgctccttcggggcc
gatccgaaggccgtggcgcggctggtggcggcccaggtggagggctaccagagcgccggg
gtcgcggccaccgccaagcacttccccgggcacggcgacacctccgtggacagccatgtc
ggcctgccgcggatcacccactcccgcaaggagtgggagcggctggacgcgccgccgttc
cgggccgcgatcgcggccgggatcgactcgatcatgacggcgcatctgctcttccccgcg
ctcgacccggccgacgaccccgccacgctctcccgccccatccttaccggtgtgctccgc
gaggagctgggctacgacggggtggtggtcaccgactcgctgggcatgcagggggtgcgg
gagaagtacggcgacgaccgggtgccggtgctcgcgctcaaggcgggggtggaccagttg
ctgaacccgccgagcctgtcccgcgccttcgagggcgtgcgcaaggccgtgcgggcgggc
gagctcgacgaggaccggatcgaccgctcgctgcggcgcatcctggaactcaaggtgcgc
cgggggctgttcgacgatccgtacaccagcgaccgcgcggtcaaccgcacggtgggcacc
cgggagcaccgtgccaccgccgaccggatcgccgagcgcaccaccacgctgatcaccaac
cgtggcgggctgctgccgctgtcgccgcgccgccggcacgacctgctggtggtgggggtg
gacgccgccgcgccctcgggcaccggcggcccgccgacggccgtcctggcccgcgccctg
tccggcctcggcttcaaggcggaggcgctgcccaccggcaccggcgactcgcccggcccc
tcgcccgagcggatcgaggcggcggtcgcggcggcgcgggggcgggacgcggtgatcgtg
gcgacgtacgacatcgcggccgggtccgcccagcgcaccctggtcgcacggctggtggct
accggggtgccggtggtgcatctggcgctgcgcgatccgtacgacatcgcgcggctgggc
ggacgcggcacggagcccggggcgtcgctggccacgtactgctggacggatgtggagctg
cgcgccgccgcccgggtgatcgcggggcgggtcaccccgcgcggcaaactgccggtcgcg
gtgcggcgcgcggacgacccgtcccgggagctgtacccgatcgggcacgggctggggtat
tga

DBGET integrated database retrieval system