KEGG   Streptomyces violaceusniger: Strvi_8131Help
Entry
Strvi_8131        CDS       T01602                                 

Definition
glycoside hydrolase
Organism
svl  Streptomyces violaceusniger
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9378213..9379409
Genome map
AA seq 398 aa AA seqDB search
MRAPPRLYALVAAAVLSVVGTALVPTAASAANGPAMTTASAAPADAPPKPSMPSKPLRPN
AAPPKLRASGNKLVDENGATRRLLGVNRSGGEFMCVQGYGIFDGPVDDASVKAIADWKVN
AVRIPLNEECWLGLSHIDPAYGGPNYIAAVKALVARLEAHGITPIVELHWSHGRYTGGDS
HCPGTEYATCQKPMPNAQYTPAFWTSVAQTFKSDQAVVFDLFNEPFPDRATSDLTAAWKC
WRDGGSCPGIDFQVAGMQTLLNAVRTAGAKNLVLIPGVAYSNDLRQWLTYKPSDPAGNLA
AAWHTYNFNTCSSESCFNEQLAPVIAQVPFVAGEIGENTCSHGYIDRVMAWLDAKGASYL
GWTWNTWDCSSGPSLISDYNGTPTNFGVGLRDHLKGMQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcacccccgcgcctttatgccttggtggccgccgcggtcttatccgtggtgggc
accgccctggtgcccaccgccgcgtcggcggcgaacggcccggccatgaccaccgcgtcg
gccgcccccgccgacgcaccgccgaagccatcgatgccgtccaagccgctccgcccgaac
gccgcaccgccgaagctgcgcgcctcgggcaacaagctggtcgacgagaacggcgccacc
cggcggctgctcggcgtcaaccgctccggcggtgagttcatgtgcgtccagggatacggc
atcttcgacggccccgtggacgacgcctccgtcaaggccatcgcggactggaaggtcaac
gcggtccggatcccgctcaacgaggagtgctggctgggcctttcccatatcgacccggcc
tacggagggcccaactacatcgcggcggtcaaggcgctcgtcgcccggctggaggcccat
ggcatcacgcccatcgtcgaactccactggtcccacggcagatacaccggaggggacagc
cactgccccggcaccgagtacgccacctgccagaagccgatgccgaacgcgcagtacacc
ccggccttctggacctcggtcgcccagaccttcaagagcgaccaggccgtggtcttcgac
ctgttcaacgagccgttcccggaccgcgccacctccgacctcacggcagcgtggaagtgc
tggcgcgacggcgggagctgccccggaatcgacttccaggtcgccgggatgcagaccctg
ctgaacgccgtaaggacagcgggtgccaagaatctggtcctgatcccgggggtcgcctac
tccaacgatctgcgccagtggctgacgtacaagccgagcgacccggcgggcaacctcgcc
gccgcctggcacacctacaacttcaacacctgctcgagcgagagctgtttcaacgaacag
ctcgccccggtcatcgcccaggtcccgttcgtggcgggcgagatcggcgagaacacctgc
tcccacggctatatcgaccgggtcatggcctggctggacgccaagggcgcctcgtatctg
ggctggacctggaacacctgggactgttcctcgggcccgtctctgatcagcgattacaac
ggcacgccgaccaacttcggcgtgggactccgtgatcacctgaagggaatgcaatga

DBGET integrated database retrieval system