KEGG   Streptomyces violaceusniger: Strvi_8302Help
Entry
Strvi_8302        CDS       T01602                                 

Definition
glycoside hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
svl  Streptomyces violaceusniger
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:svl00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:svl00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9556453..9558108)
Genome map
AA seq 551 aa AA seqDB search
MTHAAAGLIPAPRHDQSRTGRAGARIHPRHTALAAGPGTEGVARLLRTTLGQALGLSLPD
GEPGRPDTLTLRIDAALEPEGYRLTVADGRVEIAGGTAAGVHWGTQTLRQLLGPDAFRRA
PLRDAETGWELAERTVEDAPRFAWRGLMLDVARHFMPKDGVFAYLDLLAAHKLNVFHFHL
TDDQGWRVEIRRYPRLTETGAWRERTKLGHRASPLWDERPHGGYYTQDDIREIVAYAAER
HITVVPEIDIPGHSQAAIAAYPELGNTDVIDTASLGVWTTWGINPNVLAPTDNTLRFFEH
VLEEVLELFPGTFVHIGGDECPKDQWKASPAAQERIRAQGLADEDELQSWFIRHFGHWLA
ERGRRLIGWDEILEGGAPDAPLPEGAAVSSWQGYAGGIAAARAGHDVVMCPEQQVYFDHR
QAPGEDEPVPIGYVRTLEDVYRFEPVPPQLTGADADRVLGAQANVWTEVMEDRRRVDYQT
FPRLAAFAEVVWSALPPSPERDFGAFQGRMEAHYARLDALGVSYRPPAGPLPWQQRPGLL
GRPREGAPPMV
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgccgccgcggggctgatccccgcgccccgccatgaccagagccgtacgggc
cgcgcgggcgcgcggatccacccgcggcacaccgccctggccgccggccccggcaccgag
ggcgtggcgcgtctgctgcgcaccaccctcggccaggcgctcggcctgtccctgccggac
ggcgaacccggccgccccgacaccctcacgctgcggatcgacgccgcgctggagcccgag
ggctaccggctcaccgtggccgacggccgggtggagatcgcgggcggcacggccgcgggc
gtccactggggcacccagacgctccgtcagttgctcggccccgacgccttccgccgcgct
ccgctcagggacgcggagaccggctgggagctggcggagcggacggtcgaggacgcgccc
cggttcgcctggcgcggactgatgctcgatgtggcccgtcacttcatgcccaaggacggc
gtcttcgcctatctcgacctgctcgccgcccacaagctcaatgtgttccacttccatctc
accgacgaccagggctggcgcgtcgagatccgccgctatccgaggctgacggagaccggc
gcctggcgtgagcgcaccaagctcggccaccgggcgtccccgctgtgggacgagcggccg
cacggcggttactacacccaggacgacatccgcgagatcgtcgcctacgccgccgagcgg
catatcaccgtcgtgccggagatcgacattcccgggcattcgcaagccgccatcgccgcg
tacccggaactgggcaacaccgatgtcatcgacaccgcctccctcggagtctggaccacc
tggggcatcaacccgaacgtactcgcccccaccgacaacacgctccgcttcttcgagcat
gtgctggaagaggtcctggagctgttccccggcaccttcgtccacatcggcggcgacgag
tgccccaaggaccagtggaaggcgtccccggccgcccaggagcgcatccgcgcgcagggc
ctcgccgacgaggacgagctgcagagctggttcatccgccacttcggccactggctcgcc
gagcgcgggcgccggctgatcggctgggacgagatcctcgagggcggcgcgcccgacgcc
ccgcttcccgagggcgccgcggtctcctcctggcagggctacgcgggcgggatcgccgcc
gcgcgggccggccatgacgtcgtcatgtgccccgagcagcaggtgtacttcgaccaccgg
caggctccgggcgaggacgagccggtcccgatcggctacgtccgcaccctggaggatgtc
tatcgcttcgaaccggttccaccgcagctcaccggagccgacgcggaccgggtgctgggc
gcccaggccaatgtctggaccgaggtcatggaggaccgccggcgcgtcgactaccagacc
ttcccccggctcgccgccttcgccgaggtcgtctggtcggcgctgccgccctcgcccgaa
cgggacttcggggcgttccaggggcgcatggaggcacattacgcgcgtttggacgcgctc
ggcgtgagctaccgcccgcccgccgggccgcttccctggcagcagcgccccggcctgctc
ggacgcccgcgcgagggagcgcccccgatggtgtga

DBGET integrated database retrieval system