KEGG   Streptomyces violaceusniger: Strvi_8559Help
Entry
Strvi_8559        CDS       T01602                                 

Definition
pyrimidine-nucleoside phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
svl  Streptomyces violaceusniger
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Strvi_8559
Enzymes [BR:svl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Strvi_8559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9872207..9873484)
Genome map
AA seq 425 aa AA seqDB search
MDAISVIRAKRDGTRLTDAQIDWIIDAYTRGEVADEQMSALAMAIFLNGMDRAEIARWTA
AMIASGERMDFSSLPRPTADKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRAQLSNEDMLAVLRDVGPVICAAGEGLAPADKKLYALRDVTGTVESIPLI
ASSIMSKKIAEGTGSLVLDVKVGSGAFMKDIDSARELATTMVGLGNDHGVRTTALLTDMS
TPLGLTAGNALEVRESVEVLAGGGPADVVELTLALAREMLDAAGLPDADPAKALADGTAM
DHWRRMIAAQGGDPDAPLPTAREHHVVTATADGVLTRLDAYAVGLAAWRLGAGRARKEDP
VQAGAGVELHAKPGDRVTTGQPLLTLHTDTPSAFAYALEALKDAVTYAPHNTDFTTTPIV
LERIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatctccgtcatccgcgccaagcgcgacggcacccgcctgaccgacgcccag
atcgactggatcatcgacgcctacacgcgcggcgaggtggcggacgagcagatgtccgcg
ctcgcgatggcgatcttcctcaacggcatggaccgggccgaaatcgcccgctggaccgcc
gcgatgatcgcgtccggtgagcggatggacttctcctccctgccgcgcccgaccgccgac
aagcactccaccggcggcgtcggcgacaagatcaccctgccgctcgcccccctcgtggcc
gcctgcggagccgccgtaccgcagctctccggccgcggcctcggccacaccggcggcacc
ctcgacaagctggagtccatccccggctggcgcgcccagttgtccaacgaggacatgctg
gccgtactgcgcgacgtgggaccggtcatctgcgcggcgggcgagggcctggccccggcc
gacaagaagctgtacgcgctgcgcgatgtcaccgggacggtcgagtcgatcccgctcatc
gcctcctcgatcatgtccaagaagatcgccgagggcaccggctccctggtcctggacgtc
aaggtgggctccggcgccttcatgaaggacatcgactcggcgcgcgaactggccaccacg
atggtcggcctcggcaatgaccacggcgtccggacgaccgccctcctcaccgacatgtcc
accccgctcggcctcacagcgggcaatgccctcgaggtccgcgagtcggttgaggtcctg
gcgggcggcggcccggccgatgtcgtcgagctcaccctggccctggcccgcgaaatgctg
gacgcggcgggcctgccggacgccgaccccgccaaggccctggccgacggcacggcgatg
gaccactggcgccgcatgatcgccgcccagggcggcgaccccgacgccccgctccccacc
gcccgcgaacaccacgtcgtcacggccaccgccgacggcgtcctcacccgcctcgacgcc
tacgcggtcggcctggccgcctggcgcctgggcgcgggccgcgcccgcaaggaggacccg
gtccaggcgggcgcgggcgtagaactccacgccaaaccgggcgaccgcgtcacaacgggc
cagcccctcctcaccctccacaccgacaccccgtcggccttcgcctacgccctggaagcc
ctgaaggacgcggtcacctacgccccccacaacacggacttcaccaccaccccgatcgtg
ctggaacgcatcgcctga

DBGET integrated database retrieval system