KEGG   Streptomyces violaceusniger: Strvi_8616Help
Entry
Strvi_8616        CDS       T01602                                 

Definition
succinate dehydrogenase membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
svl  Streptomyces violaceusniger
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Strvi_8616
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Strvi_8616
   00650 Butanoate metabolism
    Strvi_8616
  Energy metabolism
   00190 Oxidative phosphorylation
    Strvi_8616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9928443..9928913
Genome map
AA seq 156 aa AA seqDB search
MSAETTTPASDAVSAYDVDHPAPVIEPPRARSRKTPRATRTNFEMYGWLFMRLSGVLLVV
LVLGHLLIQLVLDGGVTKIGFAFVAGRWASPFWQAWDLIMLWLATLHGANGLRTIINDYA
ERETTRLWLKALLYTAAGFTIVLGTLVIFTFDPNIR
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgagaccaccacccccgcgagcgacgcggtcagcgcgtacgacgtggatcat
ccggccccggtcatcgagccgccgcgggcccgtagccgcaagacgcccagggcgacccgt
acgaacttcgagatgtacggctggctcttcatgcgcctgtccggcgtcctgctggtcgtc
ctggtccttggccatctgctgatccagctcgtgctggacggcggtgtcaccaagatcggc
ttcgccttcgtggccggccgctgggcctcgccgttctggcaggcatgggatctgatcatg
ctctggctcgccacgctgcacggcgcgaacggcctgcgcacgatcatcaacgactacgcg
gagcgggaaaccacccgcctgtggctgaaggcgctgctctacacagcggcaggattcacc
atcgtgctcggcactctggtgatcttcaccttcgacccgaacatccgctag

DBGET integrated database retrieval system