KEGG   Streptomyces violaceusniger: Strvi_8680Help
Entry
Strvi_8680        CDS       T01602                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00984  Steroid degradation
svl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Strvi_8680
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Strvi_8680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C FAD_binding_2 DAO GMC_oxred_N Pyr_redox_2 FAD_binding_3 NAD_binding_8 Fer4_9 Fer4_10 GIDA HI0933_like Pyr_redox Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AEM87984
UniProt: G2P1N5
Position
complement(10008820..10010730)
Genome map
AA seq 636 aa AA seqDB search
MAGEKSAQNRQREPGHDEDFDAVDAVGALDDRGERGGDDDSDDGEFDYDVIVIGSGFGGS
VSALRLTEKGYRVGVLEAGRRFTPETLPRSSWDLRNYLWAPALGCFGIQRIHVLGKVMVL
AGAGVGGGSLNYANTLYVPPEPFFRDRQWGHITDWQEELRPYYDQARRMLGARLNHTLTP
SDVHLKAAAEKMGVGDTFHMAPVGVFFGDGHDADGATRAEPGQAVPDPYFGGSGPTRKAC
TECGECMTGCRHGAKNTLNENYLHLAERAGADVHPMTTVVALCDDPHGGYTVTTVPTDNR
RKGMPKALRSRYVVLAAGTYGTQTLLHTMRDKGLLPRLSERLGILTRTNSEALVGAQTTD
RRYRRARGGAERADFTRGVAITSSVHPDENTHIEPVRYGKGSNAMGMLSILQIPHGGRLP
RWLRFLGANLRHPSLAVRSLSNRRWSERTIIGLVMQTHDNSLTTYRKPKGPGKGLLTARQ
GHGEPNPDHIPEGAEAARHIADSINGFAGSNVGELMGTPLTAHFLGGCPIGASPEEGVID
PYHRLYGHPGIHVVDGAAVSANLGVNPSLTITAQAERAMSLWPNKGEPDPRPSPEAPYER
LQPVPPGTPAVPADAFGALRLPLLPVPKVPPSSPPA
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggggagaagtctgcccaaaaccggcagcgagagcccgggcacgacgaggacttc
gacgccgttgacgccgtcggcgcgctcgatgaccgcggtgaacgcggcggtgacgatgac
agcgacgacggcgagttcgactacgacgtgatcgtgatcggctcggggttcggcgggtcg
gtatcggccctgcgcctgaccgagaagggctatcgggtcggcgtcctggaggcgggccgc
cgcttcacccccgaaaccctgcccagaagctcctgggacctccgcaactacctctgggcc
ccggccctcggctgcttcggcatccagcgcatccatgtcctcggcaaggtcatggtgctg
gcgggcgccggggtcgggggcggctcgctcaactacgccaacacgctctacgtaccgccc
gagccgttcttccgggaccgccagtgggggcacatcaccgactggcaggaggaattgcgc
ccttactacgaccaggcgcggcggatgctcggggcgcgcctcaaccacaccctcaccccc
tccgacgtccacctcaaggcggccgccgagaagatgggcgtgggggacaccttccatatg
gcgcccgtgggggtcttcttcggggacggccacgacgccgacggcgccacgagggccgag
ccggggcaggccgtgcccgacccgtacttcggcggctccggacccacccgtaaggcgtgc
acggagtgcggtgagtgcatgaccggctgccgccacggcgccaagaacaccctcaacgag
aactatctccacctcgccgaacgggccggtgccgacgtccacccgatgacgaccgtcgtc
gccctgtgcgacgatccgcacggcggctatacggtcaccaccgtcccgaccgacaaccgc
cgtaagggcatgccgaaggcgctgcgctcccggtacgtcgtcctcgccgccggtacgtac
ggcacccagacgctgctgcacacgatgcgggacaaggggctgctgccgcgcctctcggag
cggctcggcatcctcacccgcaccaactccgaggccctggtgggcgcgcagaccaccgac
cgccgctaccgccgggcccggggcggggcggagcgggcggacttcacccggggtgtcgcg
atcacctcgtccgtccaccccgacgagaacacccatatcgagccggtccgctacggcaag
ggctccaacgcgatggggatgctctccatcctgcagatcccgcacggtggccgactgccg
cgctggctgcgcttcctgggcgccaacctccggcatcccagcctggccgtgcgctcactg
tccaaccgccgctggtccgagcggaccatcatcggcctggtcatgcagacgcacgacaac
tcgctgaccacctaccgcaaaccgaaggggcccgggaaggggctgctcaccgcccgccag
ggccacggcgagcccaaccccgaccacatccccgaaggcgccgaggccgcccgccatatc
gccgactcgatcaacggcttcgcgggcagcaacgtcggcgagctcatgggcactccgctg
accgcccacttcctcggcggctgcccgatcggggcgtccccggaggagggcgtcatcgac
ccgtaccaccggctctacggccatccgggcatccatgtggtcgacggcgccgccgtctcg
gccaacctgggcgtcaatccgtccctgaccatcacggcccaggccgagcgggcgatgtcc
ctgtggcccaacaagggcgagcccgacccccgcccgtctccggaggcgccgtacgaacgc
ctccagcccgtcccgccgggcacccccgccgtaccggcggacgccttcggcgccctgagg
cttcccctgctgccggtgccgaaggtcccgccgagcagccccccggcctga

DBGET integrated database retrieval system