KEGG   Streptomyces violaceusniger: Strvi_8757Help
Entry
Strvi_8757        CDS       T01602                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
svl  Streptomyces violaceusniger
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Strvi_8757
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Strvi_8757
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Strvi_8757
Enzymes [BR:svl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Strvi_8757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10107937..10109238)
Genome map
AA seq 433 aa AA seqDB search
MAVQSVESSTTSSTSDASGAFGPAIALSCRECGERFDLGPIFACEVCFGPLEVAYELPAG
DPEELRRRIEAGPNSIWRYAPLLPVPADVADQPSLHPGFTQLVKADNLARELGVTGELHI
KDDSGNPTHSFKDRVVAIAVQAARTFGFTTLSCSSTGNLAGAVGAAAARAGFRSCVFIPH
DLEAGKVVMAAVYGGELVGIEGTYDDVNRFCSELIGDPAGEGWGFVNVNLRPYYGEGSKT
LAYEICEQLGWRLPDQIVIPIASGSQLTKIDKGLKELISIGLVEDKPYKIFGAQAEGCSP
VSAAFKAGHDVVRPQKPQTIAKSLAIGNPADGPYVLDITRRTGGAVEDVNDEQIVDAIKL
LARTEGIFAETAGGVTVGVTKKLIEDGLLDPSLTTVVLNTGDGLKTLDAVAPTTGPSAII
RPTLDSFREAGLA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgcagtcagtagaaagctcaaccacttcctccacctccgacgcctccggtgcc
ttcggtcccgccatcgcattgtcctgccgggagtgcggtgagcggttcgatctgggcccg
atcttcgcgtgtgaggtgtgtttcgggccgctcgaggtcgcgtacgagctgccggccggc
gacccggaggagctgcggcggcgcatcgaggccggtccgaacagcatctggcgctatgcc
ccgctgctgcccgtccccgcggacgtggcggaccagcccagcctgcaccccggtttcacc
cagttggtcaaggccgacaacctcgcccgtgagctcggcgtcaccggtgagctgcacatc
aaggacgactccgggaaccccacccactccttcaaggaccgggtcgtcgccatcgcggtc
caggccgcccgcaccttcggcttcaccaccctctcctgctcctccaccggcaacctcgcc
ggcgcggtcggcgccgcggccgcccgcgcgggcttccgctcctgcgtcttcatcccgcac
gacctggaggcgggcaaggtcgtcatggccgcggtctacggcggtgagctggtcggcatc
gagggcacctacgacgacgtcaaccgcttctgcagcgagctgatcggcgacccggcgggc
gagggctggggcttcgtcaacgtcaatctgcggccgtactacggcgagggctccaagacc
ctggcctacgagatctgcgagcagctcggctggcggctgccggaccagatcgtcatcccg
atcgcctccggctcccagctcaccaagatcgacaaggggctgaaggagctgatctcgatc
ggtctggtcgaggacaagccctacaagatcttcggcgcccaggccgaggggtgctccccg
gtctccgccgcgttcaaggccggccatgacgtcgtccggccgcagaagccgcagaccatc
gccaagtcgctggccatcggcaaccccgcggacggcccgtacgtcctggacatcacccgc
cgtacgggcggcgcggtggaggacgtgaacgacgagcagatcgtcgacgcgatcaagctg
ctcgcccgcaccgaggggatcttcgcggagaccgcgggcggggtcaccgtcggcgtgacc
aagaagctgatcgaggacggtctgctcgacccgtccctgacgaccgtcgtgctcaacacc
ggcgacggcctcaagaccctcgacgcggtggcccccaccacgggcccctccgccatcatc
cgccccacccttgactcgttccgagaggctggtctcgcatga

DBGET integrated database retrieval system