KEGG   Streptomyces violaceusniger: Strvi_8901Help
Entry
Strvi_8901        CDS       T01602                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
svl  Streptomyces violaceusniger
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Strvi_8901
Enzymes [BR:svl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Strvi_8901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10296405..10297010)
Genome map
AA seq 201 aa AA seqDB search
MTDPVTLDGESPIGVFDEKRAENAIRELLIAVGEDPDREGLRETPGRVARAYKEIFAGLR
QEPEDVLTTTFDLGHDEMVLVKDIEVMSSCEHHLVPFVGVAHVGYIPSHDGKITGLSKLA
RLVDVFARRPQVQERLTTQVAESLMRILEPRGVIVVVECEHMCMTMRGVRKPGAKTLTSA
VRGQLRDPATRAEAMSLIMAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccggtgacgctggacggcgagagccccatcggcgtgttcgacgagaagcgc
gccgagaacgcgatccgagagctgctgatcgccgttggcgaggacccggaccgggagggg
ctgcgcgagacgccgggccgggtggcccgtgcgtacaaggagatcttcgcggggctgcgc
caggagcccgaggacgtcctgaccaccaccttcgacctgggccatgacgagatggtgctg
gtcaaggacatcgaggtgatgtcctcctgcgagcaccacctggtgcccttcgtgggcgtc
gcccatgtgggctacatcccgtcccacgacggcaagatcaccgggctgtccaagctggcc
cggctggtcgatgtcttcgcccgccgcccccaggtccaagagcggctgaccacgcaggtc
gccgagtccctgatgcggatactggagccgcgcggggtgatcgtggtggtcgagtgcgag
cacatgtgcatgaccatgcgcggggtgcgcaagcccggcgccaagaccctcacctcggcc
gtccgcggccagctacgcgatccggccacccgggccgaggccatgagcctcatcatggcc
cgctga

DBGET integrated database retrieval system