KEGG   Streptomyces violaceusniger: Strvi_8901Help
Entry
Strvi_8901        CDS       T01602                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
svl  Streptomyces violaceusniger
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:svl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10296405..10297010)
Genome map
AA seq 201 aa AA seqDB search
MTDPVTLDGESPIGVFDEKRAENAIRELLIAVGEDPDREGLRETPGRVARAYKEIFAGLR
QEPEDVLTTTFDLGHDEMVLVKDIEVMSSCEHHLVPFVGVAHVGYIPSHDGKITGLSKLA
RLVDVFARRPQVQERLTTQVAESLMRILEPRGVIVVVECEHMCMTMRGVRKPGAKTLTSA
VRGQLRDPATRAEAMSLIMAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccggtgacgctggacggcgagagccccatcggcgtgttcgacgagaagcgc
gccgagaacgcgatccgagagctgctgatcgccgttggcgaggacccggaccgggagggg
ctgcgcgagacgccgggccgggtggcccgtgcgtacaaggagatcttcgcggggctgcgc
caggagcccgaggacgtcctgaccaccaccttcgacctgggccatgacgagatggtgctg
gtcaaggacatcgaggtgatgtcctcctgcgagcaccacctggtgcccttcgtgggcgtc
gcccatgtgggctacatcccgtcccacgacggcaagatcaccgggctgtccaagctggcc
cggctggtcgatgtcttcgcccgccgcccccaggtccaagagcggctgaccacgcaggtc
gccgagtccctgatgcggatactggagccgcgcggggtgatcgtggtggtcgagtgcgag
cacatgtgcatgaccatgcgcggggtgcgcaagcccggcgccaagaccctcacctcggcc
gtccgcggccagctacgcgatccggccacccgggccgaggccatgagcctcatcatggcc
cgctga

DBGET integrated database retrieval system