KEGG   Streptomyces violaceusniger: Strvi_8930Help
Entry
Strvi_8930        CDS       T01602                                 

Definition
glycoside hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
svl  Streptomyces violaceusniger
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:svl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10327372..10328649)
Genome map
AA seq 425 aa AA seqDB search
MNSPMDQNNAPTTETKRTPRSQRLRFGIAAAVVAAAAVGGTVTAFAVNNTDGQSATTTTS
AAGAKATGAGAEGPLSTKKSEIVDSNGKKVVLTGVNWFGFETGTYAPHGLWTRSWESMLD
QMAKQGFNTMRLPYSNEMFKSSAKPNGIDWHKNPDLKGLTPQQIMDKIVKGATDRGIRVI
LDQHRPDQYGQSELWYSQSLTEKQWLDDWVKLAKRYQNNDRVIGADLHNEPRGQATWGDG
NPKTDWQLASTKAGNAIHKVNKNWLIFVEGTDRHKNEQFWWGGDLQGVKQHPVKLKEPNK
VVYSAHDYGPGVYNQNWFMAKDFPKNMPAIWDKHWAYIKKQNIAPLLMGEFGGKKTAGKS
SEAVWQNALMDYLKKHQISYTYWTWNPDSGDTGGVLKNDWKTIDQNKMKMLSKYQTPLLE
AKKGK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaattcccccatggaccagaacaacgccccgaccaccgagaccaagcgcacgccgcgc
tcgcagcgtctccgcttcggtatcgccgcggccgtcgtcgctgctgctgccgtgggtggc
accgtcactgctttcgctgtgaacaacaccgatggccagtcggccaccaccaccacctcc
gccgccggggccaaggccaccggtgcgggcgccgagggcccgctgtccaccaagaagagc
gagatcgtggactccaacggcaagaaggtcgtcctgaccggtgtgaactggttcggtttc
gagaccggcacctacgcgccgcacggcctgtggacccgtagctgggagtccatgctggac
cagatggccaagcagggcttcaacacgatgcgtctgccgtactcgaacgagatgttcaag
tcgtcggccaagcccaacggcatcgactggcacaagaaccccgatctgaagggcctcacc
ccccagcagatcatggacaagatcgtgaagggtgccaccgaccgcggtatccgcgtgatc
ctggaccagcaccgtccggaccagtacggccagagtgagctgtggtactcgcagagcctc
accgagaagcagtggctggacgactgggtcaagctggccaagcgctaccagaacaacgac
cgggtgatcggcgccgacctgcacaatgagccgcgtggccaggccacgtggggcgacggc
aacccgaagaccgactggcagcttgcctccaccaaggccggtaacgccatccacaaggtc
aacaagaactggctgatcttcgtcgagggtacggaccgccacaagaacgagcagttctgg
tggggcggtgacctccagggtgtgaagcagcacccggtgaagctcaaggagccgaacaag
gtcgtctactcggcccacgactacggtccgggtgtctacaaccagaactggttcatggcg
aaggacttcccgaagaacatgccggccatctgggacaagcactgggcgtacatcaagaag
cagaacatcgccccgctgctgatgggtgagttcggtggtaagaagaccgccggtaagagc
tccgaggccgtgtggcagaacgccctgatggactacctcaagaagcaccagatcagctac
acctactggacctggaacccggactcgggtgacaccggcggtgtgctgaagaacgactgg
aagaccatcgaccagaacaagatgaagatgctgtccaagtaccagacgcctctcctggag
gcgaagaaggggaagtaa

DBGET integrated database retrieval system