KEGG   Streptomyces violaceusniger: Strvi_8990Help
Entry
Strvi_8990        CDS       T01602                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00010  Glycolysis / Gluconeogenesis
svl00620  Pyruvate metabolism
svl00640  Propanoate metabolism
svl00680  Methane metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_8990
   00620 Pyruvate metabolism
    Strvi_8990
   00640 Propanoate metabolism
    Strvi_8990
  Energy metabolism
   00680 Methane metabolism
    Strvi_8990
Enzymes [BR:svl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Strvi_8990
Lipid biosynthesis proteins [BR:svl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Strvi_8990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEM88288
UniProt: G2P1W0
Position
10395338..10397341
Genome map
AA seq 667 aa AA seqDB search
MAWDTTDTLGMGDVVSNESLANLLREERRFAPPAELTANANVTAEAYERAKADRLGFWAE
QARRLSWATAPTETLDWSNPPFAKWFADGKLNVAYNCVDRHVENGLGDRVALHFEGEPGD
TRSLTYAELQREVSQAAHALTELGVQTGDRVAIYMPMIPETVVAMLACARIGAPHSVVFG
GFSADALATRIQDADARVIITSDGGYRRGKASALKPAVDEALTRPGTENVRSVLVVRRTG
QEVDWHEGRDVWWHEIVARQPEQHTPEAFDAEHPLFILYTSGTTGKPKGILHTSGGYLTQ
VSYTHHAVFDLKPETDVFWCTADVGWVTGHSYIVYGPLSNGATEVLYEGTPDTPHQGRWW
EIVQKYGVTLLYTAPTAIRACMKWGDDIPAKFDLSSLRILGSVGEPINPEAWIWYRKHIG
ADTTPVVDTWWQTETGGIMVSPLPGVTATKPGSAQVPLPGIAATVVDDEANEVSNGHGGY
LVLTEPWPSMLRTIWGDDQRYLDTYWSRFDKRYFAGDGAKKDDDGDIWLLGRVDDVMLVS
GHNISTTEVESALVSHPKVAEAAVVGATDPQTTQAICAFVILRGGAAEDDGLVEELRAHV
AKQLGPIAKPKRILPVAELPKTRSGKIMRRLLRDIAENRALGDVTTLTDSSVMELIQSKL
PLAPSED
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggcctgggacacaacggacaccctgggaatgggagatgtcgtgagtaacgagagcctg
gccaaccttcttcgggaggagcgtcgcttcgcgccgcccgccgagctgaccgcgaacgcc
aatgtcacggccgaggcgtatgagcgggcgaaggcggaccgcctgggcttctgggccgag
caggcccgtcggctgtcatgggcgaccgcgccgaccgagacactcgactggtcgaacccg
ccgttcgcgaagtggtttgccgacggcaagctcaatgtggcgtacaactgcgtcgaccgg
catgtcgagaacggtctgggcgaccgggtggcgctccacttcgagggcgagcccggcgac
acccgctccctcacctatgccgagctgcagcgggaggtctcccaagcggcccacgcgctg
accgagttgggggtccagacgggcgaccgggtcgccatctacatgccgatgatcccggag
accgtggtcgcgatgctggcctgcgcccgtatcggcgctccgcattcggtggtcttcggc
ggcttctcggccgacgctctcgccacccgtatccaggacgccgacgcccgcgtcatcatc
acctcggacggcggctaccggcgcggcaaggcttccgcgctcaagcccgccgtcgacgag
gcgctcacccggcccggcaccgagaacgtgcgcagtgtgctggtcgtccgccgcaccgga
caggaggtggactggcacgagggccgcgacgtctggtggcacgagatcgtggcgcgccag
ccggagcagcacacccccgaggcgttcgacgccgagcatccgctgttcatcctctacacc
tcgggcacgaccgggaagcccaagggcatcctgcacacctccggcggctacctcacccag
gtctcctacacccaccacgcggtcttcgacctcaagccggagaccgacgtcttctggtgc
accgcggacgtcggctgggtcaccggccactcgtacatcgtctacggcccgctctccaac
ggcgccaccgaggtgctctacgagggcaccccggacaccccgcaccagggccgctggtgg
gagatcgtccagaagtacggggtcaccctcctgtacaccgccccgaccgcgatccgcgcc
tgcatgaagtggggcgacgacatcccggccaagttcgacctctcctcgctgcgcatcctg
ggctccgtcggcgagcccatcaaccccgaggcgtggatctggtaccgcaagcacatcggc
gcggacaccacgcccgtcgtcgacacctggtggcagaccgagaccggcggcatcatggtc
agcccgctgccgggcgtcaccgcgaccaagcccggttcggcccaggtcccgctgccgggc
atcgccgccaccgtcgtggacgacgaggccaatgaggtgtcgaacggtcatggcggctat
ctggtgctcaccgagccgtggccgtccatgctccgcaccatctggggtgatgaccagcgc
tacctggacacctactggtcccgcttcgacaagcgctacttcgcgggcgacggcgccaag
aaggacgacgacggcgacatctggctgctcggccgggtcgacgatgtgatgctggtgtcc
ggccacaacatctcgacgaccgaggtcgaatcggcgctcgtctcgcaccccaaggtcgcc
gaggcggcggtcgtcggcgccaccgacccgcagaccacccaggccatctgcgcgttcgtc
atcctgcgcggcggcgcggccgaggatgacggtctggtcgaggagttgcgggcgcatgtc
gccaagcagctcggcccgatcgccaagcccaagcggatcctgccggtggccgagctgccc
aagacccgctccggcaagatcatgcgccgtctgctgcgcgacatcgccgagaaccgcgcg
ctgggcgatgtcaccacgctcaccgactcctccgtcatggagctgatccagagcaagctg
cccttggcacccagcgaggactga

DBGET integrated database retrieval system