KEGG   Shewanella violacea: SVI_0052Help
Entry
SVI_0052          CDS       T01206                                 

Gene name
fadB-1
Definition
(GenBank) fatty oxidation complex, alpha subunit
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
svo  Shewanella violacea
Pathway
svo00071  Fatty acid degradation
svo00280  Valine, leucine and isoleucine degradation
svo00281  Geraniol degradation
svo00310  Lysine degradation
svo00362  Benzoate degradation
svo00380  Tryptophan metabolism
svo00410  beta-Alanine metabolism
svo00640  Propanoate metabolism
svo00650  Butanoate metabolism
svo00903  Limonene and pinene degradation
svo00930  Caprolactam degradation
svo01040  Biosynthesis of unsaturated fatty acids
svo01100  Metabolic pathways
svo01110  Biosynthesis of secondary metabolites
svo01120  Microbial metabolism in diverse environments
svo01130  Biosynthesis of antibiotics
svo01200  Carbon metabolism
svo01212  Fatty acid metabolism
Module
svo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SVI_0052 (fadB-1)
   00650 Butanoate metabolism
    SVI_0052 (fadB-1)
  Lipid metabolism
   00071 Fatty acid degradation
    SVI_0052 (fadB-1)
   01040 Biosynthesis of unsaturated fatty acids
    SVI_0052 (fadB-1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SVI_0052 (fadB-1)
   00310 Lysine degradation
    SVI_0052 (fadB-1)
   00380 Tryptophan metabolism
    SVI_0052 (fadB-1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SVI_0052 (fadB-1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SVI_0052 (fadB-1)
   00281 Geraniol degradation
    SVI_0052 (fadB-1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SVI_0052 (fadB-1)
   00930 Caprolactam degradation
    SVI_0052 (fadB-1)
Enzymes [BR:svo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SVI_0052 (fadB-1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SVI_0052 (fadB-1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SVI_0052 (fadB-1)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     SVI_0052 (fadB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: BAJ00023
UniProt: D4ZDA1
Position
complement(53394..55547)
Genome map
AA seq 717 aa AA seqDB search
MIYQSPTIQVELLEDNIARLCFNAPGSVNKLDRETINSLNAALDAIQQNSDIQALVLTSG
KGAFIVGADITEFLGLFAQDDSVLLPWIAEANVVFNKLEDLPFPTISAINGFALGGGFET
VLATDFRIADTTARVGLPESKLGLVPGFGGTVRLPRLIGADNALEWITSGKDQRPEAALK
VGAIDAIVAPENLQASAIQMLKDAVAEKLDWQTRRARKQAPLTLPKLEAMMSFATAKGMV
FKIAGKHYPAPMTAISVIEKAANLGRDEALKIEHQAFVKLAKTDVTQALIGIFLNDQLVK
GKAKKAGKLAKKVDTAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLGEASKLL
AAQIKRGRSTPEKMAKVLNNITATLDYAPVKDVDLVVEAVVEHPKVKSMVLAEVEQHVAD
DAIITSNTSTISINLLAKALNKPERFCGMHFFNPVHKMPLVEIIRGENSSEETIATVVAY
ASKMGKTPIVVNDCPGFFINRVLFPYFAGFCGLLADGGDFAAIDKVMEKQFGWPMGPAYL
LDVVGLDTGHHAQAVMAEGFPDRMAKDGKDAIDIMFGAERFGQKNSKGFYAYSVDRRGKP
KKDVDAVSYELLGAEFGELKQFESDEIIARTMIPMIIETVRCLEEGIIASPAEADMGLVY
GLGFPPFRGGVFRYIDTMGVANFVALADKYAHLGGLYQVTDAMRELAANNGSYYQSK
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagtcctacgattcaggttgagttacttgaagataatatcgctcggcta
tgctttaacgcaccgggttcagtcaacaagttagatagagaaacgattaactctcttaac
gctgcactcgatgcaatccagcaaaattcagacatccaagctctagtcctgacttcaggt
aaaggcgccttcatcgttggcgccgacatcactgaattcttaggcttgttcgcccaagac
gatagtgtgctactcccttggatagctgaagcgaatgtcgtatttaataagttagaagat
cttccctttccaactatctcagccatcaacggctttgcactaggtggcggtttcgaaacc
gtactagctaccgacttccgtattgccgataccacagcaagagtgggattacctgagtct
aagctaggactggttccaggttttggaggcacggttcgcttgccacgtctaatcggtgcg
gataacgcgctcgagtggatcactagcggtaaagaccaacgtccggaagcggcgcttaaa
gtcggcgctatcgacgcaatcgttgccccagaaaatttacaagcttcagccattcagatg
ctcaaggatgcagtcgcagaaaaactcgattggcagactcgccgcgctcgaaagcaggct
ccactgacactgcctaagctagaagccatgatgtcattcgccactgccaaaggcatggtt
ttcaagatagcgggcaagcattacccggcacctatgacagccatcagcgtcatagaaaaa
gccgctaaccttgggcgagatgaagcccttaagatagaacatcaggcctttgttaagctg
gccaagacagatgtgactcaggcattgatcggtatcttcctcaatgatcagctagtaaaa
ggtaaggctaagaaggccggtaaactggctaagaaagtcgacacggctgccgtactaggt
gcaggcatcatgggtggcggtatcgcctaccagagtgccagtaaaggcactcctatcgtc
atgaaagatattgcacagccagctctggacttaggtctgggtgaagcatctaagctgctt
gcagcgcaaattaaacgtggtcgctctacaccagagaagatggctaaggtacttaacaac
atcacagcgactctggactatgctccggtcaaagatgtcgaccttgtcgtcgaagccgtt
gtcgagcaccctaaagtcaaatctatggtactggccgaagttgagcagcatgttgccgac
gacgccatcatcacctctaatacatctaccatctcgataaacctgctagctaaggcgcta
aacaagcctgagcgtttctgtggcatgcacttcttcaacccggtacataagatgccactg
gttgaaattattcgtggtgagaacagctcggaagagacgattgcgactgtagtcgcttac
gccagcaagatgggtaagacacctatcgtagttaatgattgtcctggcttcttcattaac
cgtgtgctgttcccttactttgcaggtttttgtggcctactcgccgatggcggtgatttc
gccgctatcgataaggtaatggaaaaacagtttggttggcctatgggcccagcataccta
ctggatgttgtcggtttagacacgggtcatcacgcacaggccgttatggctgaaggcttc
ccggatcgcatggcgaaagatggcaaagatgctatcgatatcatgttcggagctgaacgc
ttcggtcagaagaacagcaaaggtttctatgcttactctgtcgaccgtcgtggcaagccg
aagaaagatgtcgatgccgttagctatgaactgctaggtgccgaatttggcgaacttaag
caattcgagtccgatgagatcatcgcccgcactatgatccctatgatcatagaaaccgtg
cgttgtctcgaagaaggcattatcgcttcacctgctgaagcggatatgggtctggtttac
ggtctaggtttcccaccattccgaggcggtgtattccgctatatagataccatgggcgtc
gcaaacttcgtcgctctcgccgataaatatgctcacttaggtggcctatatcaagtaaca
gatgccatgcgtgaacttgccgcaaacaatggcagctactaccagtctaaataa

DBGET integrated database retrieval system