KEGG   Shewanella violacea: SVI_0080Help
Entry
SVI_0080          CDS       T01206                                 

Gene name
pldB
Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
svo  Shewanella violacea
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SVI_0080 (pldB)
Enzymes [BR:svo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SVI_0080 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(93252..94220)
Genome map
AA seq 322 aa AA seqDB search
MNDRVNIQTKPLSSELMLNTQEQQAFWDRVTESEIKTSDNISLAYMYIEHPGSERAIVIS
NGRIESYLKYKELIFDLYNQGYSVFAVDHRGQGLSTRTTSNPHHGYIDKFSSYIDDLAFF
IDAVVTPKQYRSLFLVGHSMGGAIGTLYMDKYPNTFTAAVFSAPMYGIKLPLCSRFIRWL
ANLLDTKDNAEPNYVLGGKDYHADDFPKNDLTSSQARYEDYRHLYQLRPELQLGSPTNHW
LVESIDVGPKLVEAARHSTTSILILQAEMDTVVDNLAQNHAVGGQCQLVKIPNARHEIFM
EKDDIRNFAVEALLKFLAIHQA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcgagttaatatccaaactaaaccactatcttctgagctaatgctcaatacc
caagagcagcaggcattctgggacagagtgactgagtcagaaataaaaacatctgacaat
atctctctcgcttacatgtatattgaacacccaggcagtgaaagagccatagtcatcagc
aacggtcgcatcgagtcttaccttaaatataaagagcttatcttcgatctctataatcag
ggctacagtgtcttcgctgtagatcatcgtggtcaagggctgtcgactcgcaccacaagc
aatccccatcatggttatattgataaatttagtagctatattgatgatttagctttcttt
atcgacgcagtggttacaccaaaacagtatcgttcactttttctagtaggccattctatg
ggtggtgccatcggcactctctacatggacaagtacccgaacaccttcaccgcagccgtt
ttctctgcacctatgtacggaatcaagctgccgctctgtagccgattcatccgctggcta
gcaaatctactcgacacaaaagataatgctgagcctaactacgtattgggcggtaaggat
tatcacgctgatgacttccctaagaatgatctaactagcagccaggctcgttatgaggat
tacagacacctttaccagctacgcccggaattacagctaggctctcccaccaaccattgg
ctggtcgagtctatagatgtcggccctaagctagtagaagctgctaggcatagcaccact
tcaatacttattcttcaggctgagatggacactgtggtcgataacttggctcaaaatcat
gccgtcggcggtcaatgccaactagtcaaaattcctaatgcccgtcatgagatctttatg
gagaaagatgatattcgcaacttcgccgtcgaggcgctgctgaagtttctggcgattcat
caagcttaa

DBGET integrated database retrieval system