KEGG   Shewanella violacea: SVI_0080Help
Entry
SVI_0080          CDS       T01206                                 

Gene name
pldB
Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
svo  Shewanella violacea
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:svo00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(93252..94220)
Genome map
AA seq 322 aa AA seqDB search
MNDRVNIQTKPLSSELMLNTQEQQAFWDRVTESEIKTSDNISLAYMYIEHPGSERAIVIS
NGRIESYLKYKELIFDLYNQGYSVFAVDHRGQGLSTRTTSNPHHGYIDKFSSYIDDLAFF
IDAVVTPKQYRSLFLVGHSMGGAIGTLYMDKYPNTFTAAVFSAPMYGIKLPLCSRFIRWL
ANLLDTKDNAEPNYVLGGKDYHADDFPKNDLTSSQARYEDYRHLYQLRPELQLGSPTNHW
LVESIDVGPKLVEAARHSTTSILILQAEMDTVVDNLAQNHAVGGQCQLVKIPNARHEIFM
EKDDIRNFAVEALLKFLAIHQA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcgagttaatatccaaactaaaccactatcttctgagctaatgctcaatacc
caagagcagcaggcattctgggacagagtgactgagtcagaaataaaaacatctgacaat
atctctctcgcttacatgtatattgaacacccaggcagtgaaagagccatagtcatcagc
aacggtcgcatcgagtcttaccttaaatataaagagcttatcttcgatctctataatcag
ggctacagtgtcttcgctgtagatcatcgtggtcaagggctgtcgactcgcaccacaagc
aatccccatcatggttatattgataaatttagtagctatattgatgatttagctttcttt
atcgacgcagtggttacaccaaaacagtatcgttcactttttctagtaggccattctatg
ggtggtgccatcggcactctctacatggacaagtacccgaacaccttcaccgcagccgtt
ttctctgcacctatgtacggaatcaagctgccgctctgtagccgattcatccgctggcta
gcaaatctactcgacacaaaagataatgctgagcctaactacgtattgggcggtaaggat
tatcacgctgatgacttccctaagaatgatctaactagcagccaggctcgttatgaggat
tacagacacctttaccagctacgcccggaattacagctaggctctcccaccaaccattgg
ctggtcgagtctatagatgtcggccctaagctagtagaagctgctaggcatagcaccact
tcaatacttattcttcaggctgagatggacactgtggtcgataacttggctcaaaatcat
gccgtcggcggtcaatgccaactagtcaaaattcctaatgcccgtcatgagatctttatg
gagaaagatgatattcgcaacttcgccgtcgaggcgctgctgaagtttctggcgattcat
caagcttaa

DBGET integrated database retrieval system