KEGG   Shewanella violacea: SVI_0127Help
Entry
SVI_0127          CDS       T01206                                 

Gene name
bcsZ
Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
svo  Shewanella violacea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SVI_0127 (bcsZ)
Enzymes [BR:svo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SVI_0127 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(146998..148113)
Genome map
AA seq 371 aa AA seqDB search
MKKLVWLTCLSLMLTSLSSQVFALECQWPEWNTFKTNYLQDGRVVDASDPRLITTSEGQS
YGLFFALVANDKQAFQQILTWTETHLAEGDLTAHLPAWLWGQKTTGTYGVLDNNSASDSD
LWIAYSLAEAGRLWDNYYYKSLSHLVASRILREETLEVPGIGNVLLPGPQGFDKPDGSYR
LNPSYVPLQLLSRMATLYPKYTWQSLYKTSATMLTDTAQHGFSPDWVTLKSGVYTADDIT
GNLGSYNAIRSYLWIGMLNDADKEKSTLLQTMQAMVAATQQLSAPPREVDTLNGQYTEAG
SPGFSAALLPFLSASNQAALVEQQAERAHSLLQRNDGKHYYDNVLGLFGEAWYQERFRFG
EHGELQTQCQK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagtctggctcacttgtttgtccctgatgcttacatccttgtcatctcag
gtttttgcgcttgagtgtcaatggccagaatggaatacattcaaaacaaattacctccaa
gatggcagagtggtggatgccagcgatccgcgcttaattaccacatcggaaggacaatct
tatgggttgtttttcgccttagtagccaacgataagcaggcatttcaacaaatattaaca
tggacagagacacatcttgccgaaggtgatctgaccgcacatttacccgcatggctatgg
ggacagaagacgactggaacgtacggggtactagataataattcagcatctgattctgat
ttatggatagcatatagcttggctgaagccggacgactctgggataactactactataaa
tcccttagtcatctagttgccagtcgcatacttagggaagaaaccctagaggtcccaggt
attggtaacgtgctcctacccgggccccagggcttcgataaacccgatgggagctaccgc
ttaaatcccagctacgtgcccttgcagttgctgtcacgaatggcgacactctaccccaag
tacacatggcaatccttatataagaccagtgctactatgttaaccgacactgcacaacac
ggctttagcccagattgggtaacactaaagtccggggtgtacaccgccgatgacatcaca
ggaaatctaggtagctataacgcgattcgcagctatttatggataggtatgcttaacgat
gccgataaagaaaaatccacattattgcaaaccatgcaagctatggtggccgcgacacag
caactctcagcgccaccacgggaagtggataccctaaacggccaatatacagaggcgggc
agcccaggtttctctgccgcattattgccatttctttcagcttcgaatcaagctgcatta
gtggaacaacaagctgagcgggctcactcattattgcagcgcaatgatggcaaacattac
tacgataatgttttgggtctgtttggtgaagcttggtatcaagagagattccgttttggt
gagcacggagagttacaaacccaatgtcaaaagtaa

DBGET integrated database retrieval system