KEGG   Shewanella violacea: SVI_0265Help
Entry
SVI_0265          CDS       T01206                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
svo  Shewanella violacea
Pathway
svo00010  Glycolysis / Gluconeogenesis
svo00020  Citrate cycle (TCA cycle)
svo00620  Pyruvate metabolism
svo01100  Metabolic pathways
svo01110  Biosynthesis of secondary metabolites
svo01120  Microbial metabolism in diverse environments
svo01130  Biosynthesis of antibiotics
svo01200  Carbon metabolism
Module
svo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVI_0265 (aceF)
   00020 Citrate cycle (TCA cycle)
    SVI_0265 (aceF)
   00620 Pyruvate metabolism
    SVI_0265 (aceF)
Enzymes [BR:svo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SVI_0265 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding RnfC_N GCV_H Biotin_lipoyl_2 HlyD_D23 HlyD_3 NQRA
Motif
Other DBs
NCBI-ProteinID: BAJ00236
UniProt: D4ZEK6
Position
312640..314511
Genome map
AA seq 623 aa AA seqDB search
MTIEINVPDIGADEVEVTEILVSVGDKVEEEQSLIAVEGDKAAMEVPASRAGIVKEIKVA
IGDKVATDALIMIFEDEAASAPVAQAAAAPVPVAATAAPASVELKEVNLPDIGDDEVEVT
AILVSPGDIITEDQAILSVEGDKASMEVPAPFNGVLKEIKVEIGDKVSTGSLVMVFEIAG
SSAAPVAAPVTPVAAPVATAASVLEVAVPDIGDDEVEVTEIMVKVGDTVTEEQSLISVEG
DKAAMEVPAPFAGTIKEIKVATGDKVSTGSLIMIFEVAGQAPAAAPVVAAPAQVAPVQAS
ASTAKPAKTDFVENDAYAHASPVIRRLAREFGVNLANVKGTGRKNRVIKEDVQNYVKAAV
KQVESGSVKAAAGGNELNLLAWPKIDFSKFGETEVKPLSRIQKISGANLHRNWVKIPHVT
QWDNADITELEVFRKAQNAAEAKKDSGMKITPLVFIMKAVAKALETFPTFNSSLSEDGQS
LILKKYVNVGIAVDTPNGLVVPVFKDVNKKGIHELSDELKVISKKARSGKLTASDMQGGC
FTISSLGGIGGTAFTPIVNAPEVAILGVSKSEMKPVWNGKDFEPRLMLPLSLSYDHRVVD
GAEGARFISYLNSCLSDIRTLVL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaattaatgtacctgatattggtgcggatgaggttgaagtcaccgagatc
ttagtcagcgtaggcgacaaggttgaagaagaacaatcgctgattgctgtcgaaggcgac
aaggccgcgatggaggtgcctgcatctcgagcgggtatagtgaaagagattaaggtagct
attggagataaggtggctaccgatgcattgatcatgatcttcgaagacgaagcagcatcg
gctcccgtggctcaagctgcggcagctcctgtgccagtagcggccacagccgctccggca
tctgtcgagcttaaagaagtgaatctgcctgatatcggtgacgatgaagtcgaagtgact
gcaatcttagttagccctggtgatattatcactgaagatcaggcaatcttaagcgtcgaa
ggtgacaaggcgtcgatggaagtaccggctcctttcaatggcgtcttaaaagagattaaa
gttgagattggtgacaaggtttctaccggtagcttagtcatggtattcgaaatagcaggt
tcatctgctgcgccagtggccgctccagtaacacctgtggctgctccggttgccactgct
gcatcggtactagaagtagccgtccccgatattggtgatgatgaagtcgaagtgactgag
atcatggtgaaagtcggtgatacagtgaccgaagagcagtcactgattagcgtcgaaggc
gacaaggctgccatggaagtaccggctcctttcgctggtacgattaaagaaatcaaagtc
gccactggtgacaaggtttctactggctcgttaatcatgattttcgaagtagctggccaa
gcgcctgctgcagcaccagtagttgctgcaccggctcaagtagctccagttcaagcatct
gcatcgacagcgaaaccagctaaaactgattttgtagaaaatgacgcttatgcccatgca
tctcctgtgatccgtcgccttgctcgtgagtttggtgtaaacctggcaaatgtcaaaggt
actggtcgcaagaatcgtgttattaaagaagatgtgcagaattacgttaaggctgcggtt
aagcaagttgaatcgggtagtgttaaagctgccgctggtggcaacgagcttaacttacta
gcatggccaaagatcgatttcagcaagtttggtgaaaccgaagttaagccattatctcgt
attcagaagatttcaggtgctaacctacacagaaactgggtgaagatcccccatgtgact
cagtgggataatgcagatataactgaactcgaagtattccgtaaggcgcaaaacgcggcg
gaagctaagaaagattccggcatgaagatcactcccttggtgtttatcatgaaggcggtt
gctaaggctctggaaactttcccaacctttaattcttctctgtctgaagatggccaaagt
ttgatcctgaagaagtacgtcaatgttggtattgccgtcgatacgcctaatggtctagtt
gtccctgtgttcaaagatgtgaacaagaaaggcatccatgagctatcggacgagctaaag
gtgatatctaagaaggcccgtagcggcaagttaaccgcttcagacatgcaaggtggttgc
ttcactatttctagcctaggtggcataggtggaacggcatttacaccaatcgttaatgca
cctgaagtggcaattcttggggtatctaagtctgagatgaagccggtatggaatggtaaa
gatttcgagccgcgcttgatgttgcctctgtcactatcttatgatcatagggtcgtagat
ggcgccgaaggtgcacgttttatcagctatttaaacagctgcttatcagatattcgtact
ctggtactttaa

DBGET integrated database retrieval system