KEGG   Shewanella violacea: SVI_0635Help
Entry
SVI_0635          CDS       T01206                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
svo  Shewanella violacea
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SVI_0635 (rbsK)
Enzymes [BR:svo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SVI_0635 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
757513..758427
Genome map
AA seq 304 aa AA seqDB search
MAKLSVLGSINVDHLMQVGAAPRGGQTIQAKQYQIVAGGKGANQAVAAAKLGADVAMIAC
IGTDAIGEQMKQGLADIGIDTKGITTITGENTGVAMIYVEDSGENRIGIWPGANASLTET
VMSEHKASIQDSDLLLLQLETPVETLVAAAKIAKAAGTRVVLNPAPAKALPEALLSNVDI
ITPNETEAEQLTGVAISELSDADMAANKLHTKFGIETVLITLGERGVWLSHKGEGKHIAG
FVMQAIDTTAAGDTFNGGFVTGLLEGQSMLDSVRFGQAAAALSVTRMGAQSSIPTRVETL
ALLA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggccaaattatccgtattgggcagcatcaacgtagatcacctgatgcaagtcggcgcc
gcgccaagaggcgggcagactattcaagccaaacagtaccaaatagtagcgggtggcaag
ggtgcaaatcaggctgtggccgcggccaagctgggagctgacgtggctatgatagcctgt
atcggcactgacgccattggcgagcagatgaaacaaggtctcgccgatataggtatagat
accaagggcatcactacaattaccggtgaaaataccggcgtggcgatgatttacgtcgag
gactcgggtgaaaaccgtatcggtatctggcccggtgctaacgcttccctgactgagact
gtgatgtctgagcataaggccagtattcaagactcagacttgctcttgctccagctggaa
acgcctgttgagactttagtcgcggcggctaaaatagccaaagctgccggtactcgagtg
gtgttaaatcccgcccctgctaaggcgttaccggaggctttattatctaatgttgatatc
attacgcccaatgagaccgaagccgagcagctgaccggcgtggccatcagtgagttatca
gatgctgatatggcggctaataagctgcacactaaatttggtatcgaaactgtgctgatc
accttaggcgaacgtggtgtatggttgtcacataagggcgagggtaagcacatcgccggt
ttcgtgatgcaggccatagatacaacggctgccggggacacctttaacggcggtttcgtt
accggattactggaaggtcaatctatgctggattcggtgcgttttggtcaggcggccgcg
gcattgtccgtgactcgcatgggggcacaaagttcaattccgactcgggtagaaaccttg
gccttgctagcttaa

DBGET integrated database retrieval system