KEGG   Shewanella violacea: SVI_0885Help
Entry
SVI_0885          CDS       T01206                                 

Gene name
folK-1
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
svo  Shewanella violacea
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:svo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1032918..1033448
Genome map
AA seq 176 aa AA seqDB search
MLSRVYISLGSNIEPERYLKSGLNDLSSHFGQLLLSSVYESEAVGFEGSNFLNMVVGVDT
DLSISELVSLFKQIEQDNGRLVGAKKFASRTLDLDLLLYDDMATLDPVELPRAEILTNAF
VLWPMAELAPDLVHPLVDISYQTLWDEYDKNQQRLWPIPFSWTQVQADEASMINSL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgttatcgcgtgtctatatcagcttaggcagtaatatcgagcctgagcgctaccttaag
tctggattaaatgatcttagttctcattttggccagctgctgctctcctctgtgtatgaa
agtgaagccgttggatttgaaggcagtaactttttaaatatggtggttggcgtcgatacc
gatttgagcataagtgagctagtgtccttgtttaagcagatagaacaagacaatggccgt
ctggtaggggctaaaaagtttgcttctaggacattggatctggatctcttactctatgat
gacatggcaacactcgatcctgtcgagctgccgagagctgaaatcttaaccaatgccttc
gtgctatggcctatggctgagctggcacctgatttagttcatcctttggtagatattagc
tatcaaaccctgtgggatgaatatgataaaaatcagcaaagactttggccgatcccattt
agctggactcaggtccaggcagatgaagcctcaatgattaactcactctaa

DBGET integrated database retrieval system