KEGG   Shewanella violacea: SVI_0977Help
Entry
SVI_0977          CDS       T01206                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
svo  Shewanella violacea
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SVI_0977 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SVI_0977 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SVI_0977 (thrC)
Enzymes [BR:svo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SVI_0977 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1141166..1142446
Genome map
AA seq 426 aa AA seqDB search
MELYNLKHPSQVVSFTQALKQGLGKDRGLFFPTSIPVLDDVDSLLALPFVARCQKILGAW
LASELGQDTVDRLVEKAFNFELSLAKVDDNRHCLELFHGPTLAFKDFGARFMAQCLNELA
ADDKINILTATSGDTGAAVADAFFGLDKIKVVVLYPKGKISLLQEKMFTTLGDNIHTVAV
ESDFDACQALVKRAFEDSDIRDGLHLNSANSINISRLLAQICYYFEAVAQFKRQHDQDPV
ISVPSGNFGNLTAGLFAQAMGLPVKRFIAATNSNDTVPRYLEKGDWLPNATVGTMSNAMD
VAEPSNWPRVEAIIEKMNWSLADISGVALSEADTSTALKQLNDAGYLSEPHAAIAAQALN
MTMTPGEKGIFLGTAHPAKFKDVVDRELGMNLPLPPELAAVADKAILSVTLDNSFAELKA
HLFKVL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggaattgtacaatttaaaacatccttctcaggtggtgagttttacccaagcgcttaag
caaggtttaggcaaagacagagggctcttctttccaacctctatcccagtattggatgat
gtcgactcgctactggcactgccgtttgtggcacgatgtcaaaaaatattgggcgcctgg
ctagcctctgagctgggacaagatacagtggaccgtttggttgaaaaagcatttaatttt
gagctttcgttggcaaaagttgatgataacagacactgtttagagttatttcatggacct
accttagcctttaaagactttggtgccaggtttatggctcaatgcttaaatgagctggca
gcagacgataaaattaatatcctgactgctacttctggtgataccggcgctgcggttgcg
gatgccttctttggtttagacaagatcaaggtagttgttctctaccccaagggaaagata
agcctgctgcaggagaaaatgttcactaccttaggtgacaacatacatactgtcgcagtg
gagtcggatttcgatgcctgtcaggcgttggtaaagcgagcattcgaagatagtgatatc
cgtgatggtttgcatcttaactcggctaattccatcaatatcagtcgtctgctggctcaa
atttgttactactttgaagccgtggctcagtttaagcgccaacatgatcaagatccggtt
atctcagtgcctagtggtaacttcggtaacttaactgcaggtctgttcgctcaagccatg
ggcttaccggttaaacgctttattgcagcaaccaacagcaatgataccgtgccacgttac
ttagaaaagggtgattggttacctaatgcgacggtcggcactatgtccaatgccatggat
gttgccgagccgagtaattggcccagagtcgaagccatcatagagaagatgaactggtca
ctggcggacatctcaggtgtggcactgtcagaagctgatacttccacagcattgaaacag
ttaaatgatgcgggttatctgtcggagccccacgcagctattgccgctcaggctttgaat
atgacgatgacaccaggtgagaaaggcatctttctcggcactgctcacccggctaaattt
aaagatgttgtcgatcgtgaactgggtatgaacttacctttaccaccagaactcgcggct
gtcgccgataaagcaattttgtcagtcaccttagataacagttttgccgaactaaaggcc
catctgtttaaggtgttataa

DBGET integrated database retrieval system