KEGG   Shewanella violacea: SVI_1022Help
Entry
SVI_1022          CDS       T01206                                 

Gene name
hex
Definition
beta-hexosaminidase B precursor
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
svo  Shewanella violacea
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SVI_1022 (hex)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SVI_1022 (hex)
Enzymes [BR:svo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SVI_1022 (hex)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1192619..1195273
Genome map
AA seq 884 aa AA seqDB search
MITAAITLVLVTSACSDTNIATNNPESAHSSQAKANSLDQVQLNTLGDTLEIKYRVVTNY
PQGCSTSGVDGRCFTAQIDLTSAVDLDSHDWAIYFSQMRPVQSVNSKEFTITRVKGDLHK
IAPTTEFTGLKQGITKTIEFKGELWQLSETDAMPNYYLVSAELEPVLIKSTAVTLDSETG
MELRPYVVSFTDEDKQYKRSDTDKVKWATAEVLFQANQGIDFQPELVTNTIIPTPLRLEV
SSTDKPVSLKGGIKLELNDVKRQAIDAALARLSRIGVKEASSGLVVSLLPLEMKSTSGAY
LLDIAKDKITISAADDAGFSYGLSSLTSLLDSNDLVINTMRVEDSPRYDFRGMHIDVSRN
FHSKQLVLDMLDQMAAYKLNKLHLHMADDEGWRLEIDGLPELTDIGSKRCHDLSETRCLL
PQLGSGPFAAAKVNGYYSKADYIEILKYAGARQIQVIPSMDMPGHSRAAIKSMEARYRKL
AATGDIKGANEYRLVDPKDTTVYSSIQYYDDNTLNVCMESTFHFVDKVIDEIAKLHQQAG
QPLSVYHIGADETAGAWLDSPICKAFLAKNNQGVTTSDEFGAYFIERVSNTLHDKGIEPA
GWSDGMSHTRPQNMPKASQTNVWDVISHKGFRRAHQQANLGWDAVLGMPEMLYFDFPYEA
DPKEHGYYWASRNTNERKLYGFMPDNLPANAEQWTDIQGEPFEADDTEKRDEAGKLVSGP
MKQGMSFSGLQGQIWSETLRSDSVVEYMTFPRLLILAEKAWHKASWEVPYQYKGAVYNHT
SGYFTQEMRNEQASQWAVLANTLGQKELLKLDMAGIEYRVPTVGAHIHDGKLLTNLIYPG
LTVEYRLKGGEWLVYHSPVAISGQVEVRAVAADGKRKGRSLIVR
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
ttgatcactgccgcaatcacgcttgtgttagtaacaagcgcttgctcagatacaaacatt
gcaacgaataaccccgagtcagctcattccagtcaagctaaggctaacagcctagatcaa
gtacaactaaacacacttggcgatacattagagattaagtatcgggtagtgactaactac
ccgcaaggatgttcgacttcaggtgtcgatggccgttgcttcacggcgcagatagatctg
acctcagctgtcgacttagacagtcacgattgggctatctatttcagtcagatgcgtcca
gtgcagtcggtgaattccaaagagtttactattactcgagtcaaaggcgatctacataag
atagcgccgactactgagtttacaggactcaagcagggcatcactaagaccatagagttt
aaaggtgagctgtggcaactatctgaaaccgatgctatgccaaactattacctggtatca
gctgagttagaaccggtacttatcaagagcacggcagtgacgctggacagtgaaactggc
atggagcttcgtccctatgtggtgtcattcaccgatgaggataaacagtataagcgcagt
gataccgataaagtgaagtgggcaacagctgaggtactatttcaggctaatcagggaata
gactttcagcccgagctggtcaccaacacgataatcccaactcctttgaggcttgaagtc
agctcaaccgataagcctgtgtcccttaaaggcggcattaagcttgagcttaatgatgtt
aaacgccaagccatagatgcagcacttgctcgcctgagccgcatcggtgtcaaagaggca
tcgtctggtctagtcgttagtctcttaccactggagatgaagtctacatctggcgcatat
ttgttagatatcgccaaggataaaatcaccatctctgcggcggatgatgcgggtttctcc
tatggcctatcttcactgaccagtcttctcgatagtaatgacttggttattaacaccatg
agagtcgaagattccccccgttatgattttcgcggcatgcacatagatgtgtcgagaaat
tttcacagtaagcagctggtgttggatatgttagatcagatggcggcctataaactgaat
aagctgcatctgcacatggccgacgatgagggttggcgtctggagatagacggcttacct
gaactcacagatatcggcagcaagcgatgtcatgacttgagtgaaacaaggtgcttgtta
cctcagcttggtagtggcccgtttgccgctgctaaggtcaatggctattactcaaaagcc
gattatatcgagatattaaaatatgctggcgccagacagattcaggtcattccctcaatg
gatatgccgggacactcaagagcggccatcaagtccatggaagcgcgttatcgcaagcta
gctgcaaccggtgacataaaaggggctaatgagtatcgtttggtcgaccctaaagacacc
actgtctattcatcgatccaatactatgacgataacacccttaacgtgtgtatggagtcg
acctttcacttcgtcgataaggtaatcgacgagattgctaaattgcatcaacaagcgggt
cagcctctatctgtctatcatattggtgccgatgaaactgccggtgcctggttagactct
ccaatttgtaaggcgtttcttgccaaaaataatcaaggcgtgaccacaagcgatgaattt
ggtgcctattttatcgagcgtgtatcgaataccttgcatgataaaggtatagagcctgcg
ggttggagtgatggtatgagccatacccgtccacagaacatgccgaaagcctcccaaacc
aatgtatgggatgttatctcacacaaggggtttcgccgcgcgcatcagcaagccaattta
ggttgggacgcagtattgggtatgcctgagatgctttattttgattttccctatgaggct
gatcctaaagagcatggatattactgggcgagtcgtaacaccaacgagcgtaagttatat
ggttttatgcctgacaacttgccggccaatgccgaacagtggaccgatattcaaggtgag
cccttcgaagccgacgacactgagaaacgagatgaagcaggtaagctagtcagtggccca
atgaagcaagggatgtctttttccgggcttcaggggcagatctggagtgaaacactcaga
agcgattccgtggttgaatatatgacttttccacgtctacttatcttggctgagaaagcc
tggcataaggcgagctgggaagtgccctatcaatataaaggggctgtttataatcacact
agcggctactttacccaagagatgcgcaatgagcaggctagccagtgggctgtattagct
aatactctggggcaaaaagagttacttaaactcgatatggctggcatcgaatatcgggta
cccactgttggtgctcatatacatgatggaaagctgctaacgaatcttatctacccgggt
ctgaccgttgaatatcgacttaaggggggtgagtggcttgtttatcattctcctgtcgct
atctctggtcaagtagaagtcagggccgtagcggccgatggtaagaggaaaggccgttcc
ttaatcgtaagataa

DBGET integrated database retrieval system