KEGG   Shewanella violacea: SVI_1033Help
Entry
SVI_1033          CDS       T01206                                 

Gene name
glsA
Definition
(GenBank) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
svo  Shewanella violacea
Pathway
svo00220  Arginine biosynthesis
svo00250  Alanine, aspartate and glutamate metabolism
svo00471  D-Glutamine and D-glutamate metabolism
svo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SVI_1033 (glsA)
   00220 Arginine biosynthesis
    SVI_1033 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SVI_1033 (glsA)
Enzymes [BR:svo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SVI_1033 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: BAJ01004
UniProt: D4ZH55
Position
1205183..1206109
Genome map
AA seq 308 aa AA seqDB search
MVELVPELALLEQVVDKVRPLLGQGKVADYIPELAKVNPNKIGIAVTSIDGTTIGAGDYL
EPFSIQSISKVFSLTLALTLYEEQEIWSRVGKEPSGQSFNSLVQVELEQGLPRNPFINAG
ALVIADLLQARLGAPKHRMLELIRELSTNPKLISDRVVAASEYEHSARNAAIAYLMKSFG
NFNNDVDTVLQSYFHYCAIRMNCADLSKAILYLANKGKCLDGSQLLSPVQTRQMNALLAT
SGLYDGAGEFAYRVGMPGKSGVGGGIIAVIPGDMAVCVWSPELDLNGNSLAGTAALEELC
QRLGRSIF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttggtggagttagtgcccgaattggcattactcgagcaggtggtcgataaagttcggccc
ctgctaggccaaggtaaagtggctgactatatcccagaattggcgaaggttaatcctaat
aaaattggcatcgcagtcaccagtatcgatggtacaactataggtgccggagattatctg
gaacctttttcaattcaaagtatctccaaagtatttagcctgacattagcgttaactctc
tatgaagagcaagagatctggtctcgggttggtaaggagccttcggggcagtcctttaac
tcactggttcaggttgaattagagcaaggtctccctagaaatccctttattaatgcgggc
gcactcgtcattgcggacctgctacaagctcgattaggtgcacctaagcataggatgctc
gaactcattcgtgagctgagtaccaatccaaaactcatttcagatagagtcgtggctgct
tctgagtacgaacatagcgcaagaaatgcggctattgcttacttgatgaagtcttttggc
aactttaacaacgatgttgatacggttctgcaaagctactttcattattgtgccatacga
atgaactgtgccgatctgtcaaaagccatcttgtacctggctaataagggtaaatgttta
gatggttctcagttactctctccggtacaaactcggcagatgaatgcattattagccacc
tcgggactatacgatggtgccggcgaatttgcttatcgagtcggtatgcctggtaagagt
ggtgtcggcggcgggatcattgccgttatccctggtgatatggccgtgtgtgtctggtct
cccgagctagatcttaatggtaattctctggcaggtactgccgcgctcgaagagctgtgt
caaagactgggtcgttctattttctag

DBGET integrated database retrieval system