KEGG   Shewanella violacea: SVI_1073Help
Entry
SVI_1073          CDS       T01206                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
svo  Shewanella violacea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:svo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1247928..1250321
Genome map
AA seq 797 aa AA seqDB search
MGLEKLLYLQGVGAEFINFSGQNIRIPVQDREGVLRCMLDKLADTRGGIDAKYLDRRIHE
LDAEPWTVGLHGFQHSYLDDPEISLYLPYDYQGELTLRILSESDCLFCLRLLPADMQIVG
DYHIGKTQYLHYRLSLLKLIPAGSEDAKLATDTDTDTATECVESKLDSSDVIEAKNQRLG
LGYHSAELIAGKYRYSGIVMMAPRQAFRLSDINSDTDSDINSDTDLDISSDTDLDINSDI
DLDISSDVDLDINSDTDTGSDINSEIASDKTSVSTTNTNTNTNTRPWGLSIQLYSLRSDN
QWGIGDFGNLTEIIDWVAEHGGDFIQLNPLHALDIAEPEQVSPYSPSDRRRINPLYIHIQ
AVPEYAQAKFRLQSDEFEALRRSINIDNWLDFPQLTLIKYRAFIILYQVFSLSDTKSSSV
RRQEFDDFVLREGEALTQFVLAESAKAGDELPKNLDFYRFLQFVAEEQICACQTNAKQAG
MSLGLIRDLAVGASPGGVEVRQNPSQFCLDASIGAPADPFAPQGQNWGLAPLDPISMKKD
NFQHVISIVRGNMRHCGALRIDHVMSLLRIWWCPLDEDLGQGAYVYYPVDSLFAILCLES
WRAQCCIIGEDLGLVPPEMDLRLRSSGIYSNQLFYFCKHSKGFMSPGEHKQDSLMMLANH
DVPNLAAWWSASDLHLRRQLELIDNDAALGDALNGRELEKQQLLSLLVSLECIDKSAVDS
LEYEALLEAWISASALSHSALFSVQLSDLIGEIHSVNIPGTWQEYPNWQRRLPISLSAIK
ESSQVNNLLERIRAARK
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggggctggagaagttactgtatctgcagggcgtcggtgccgagtttatcaattttagt
ggccagaatatccgtatcccagttcaggacagagagggggtattgcggtgcatgctggat
aaattagccgatactcgaggtggaatcgatgccaagtatctggataggcgtattcatgaa
ctcgatgccgagccatggaccgtggggcttcatggttttcagcatagctatcttgacgat
cctgagattagtctgtatctgccctatgattatcaaggtgaattgacgctgaggatcttg
agtgaatcggactgcttattctgtcttaggctgcttccggccgatatgcagatagtcggt
gattaccacataggcaagactcaatatttacactatcgcttatctctgctgaagttaata
ccagccggttcagaagatgccaagctggctactgatactgatactgatactgctacagag
tgtgtcgagtcgaaacttgattcttctgatgtgattgaggcaaagaatcagcgattaggt
ctaggctatcacagcgccgaattgatcgcggggaaatacaggtattcaggtatcgtcatg
atggccccaagacaagcatttaggctctcagacataaactcagatacagattcagacata
aattcagatacagatttagacataagttcagatacagatttagacataaattcagatata
gatttagacataagttcagatgtagatttagacataaattcagatacagatacaggttca
gacataaattcagagatagcttcagataaaaccagtgtctcgacgactaatactaatact
aatactaatactcggccttggggactcagtattcagctctactccctgcgcagtgataat
cagtggggtattggagattttggtaacttgactgaaattatcgactgggtggccgagcat
gggggagattttattcagctcaacccactacatgccttagatatcgctgagccagaacag
gtgagcccctatagccccagtgacaggcgcagaattaatcctctctatattcatatccaa
gctgttcctgagtatgcccaagcaaagtttaggttgcagtcagatgaatttgaggctctg
aggcgatccatcaatatcgataattggttggatttcccccaattgactctgattaaatat
cgagcttttatcattttgtatcaagtgtttagtctgtcagataccaagagttcatcggtc
aggaggcaggaattcgatgattttgtgctcagggagggggaagcactgactcaatttgtc
ctggccgagtcggctaaagctggggatgaattacccaagaatctcgacttctatcgattt
ttacagtttgttgccgaagagcaaatctgtgcctgtcagactaatgccaaacaagccggg
atgtcattaggcctgatacgggatctcgctgtgggcgctagcccaggaggagtcgaagtc
aggcaaaacccatcgcaattttgcctcgatgccagtattggcgccccagcggatccattt
gcacctcaaggacaaaattggggcctggctcccttagacccaatttcaatgaaaaaagat
aattttcaacatgttatttcaatagtgaggggcaatatgcgccactgtggtgcattgaga
atcgatcacgtgatgtctttgctgagaatatggtggtgccccttggatgaggatctcggt
cagggagcctatgtgtattatccagtagacagcctcttcgccatcctatgtcttgaaagc
tggcgagcccagtgttgcatcataggagaagatctcggtctggttcctcccgagatggat
ctgcgcctgagatcttcgggcatctattctaaccagctgttctatttttgtaagcacagc
aaaggttttatgagtccaggtgagcataaacaagacagtttaatgatgctggcaaatcac
gatgtgcctaacttagccgcgtggtggtccgccagtgatctgcacctgagacgtcagctg
gagcttatcgacaatgatgcagccttgggggatgccttaaacggccgtgaacttgagaaa
caacagttgctcagcttgcttgtgagtcttgaatgtatcgacaaatccgcagtggacagt
ctcgagtatgaggcgttacttgaggcctggataagtgcatcagccctgagtcattcggcc
ctatttagtgtgcagcttagcgatcttattggcgaaatacacagtgtgaatattcctgga
acctggcaagagtatcccaattggcagcgacgtttgcctattagcctctcggctataaaa
gaatctagccaggtgaataacctgttagagcggataagggcggcgagaaaataa

DBGET integrated database retrieval system