KEGG   Shewanella violacea: SVI_1453Help
Entry
SVI_1453          CDS       T01206                                 

Gene name
cheB-2
Definition
chemotaxis response regulator protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
svo  Shewanella violacea
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:svo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:svo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1663265..1664386
Genome map
AA seq 373 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSDIVNKDPDLEVVGTAVNGADAVKLVAELKPQVITMDIEMPV
MDGITAVREIMAKNPTPIIMFSSLTHDGAKATLDALEAGALDFLPKRFEDIATNKEDAVL
LLQQRIKALGRRRIYRPLTRTSAPSAPSAKAKLTSGLSPSSRTGRETATSLRTTTLIRAT
GKKYRLLLIGTSTGGPVALQRILTKLPANYPHPILLIQHMPAAFTPAFASRLNGLCKIEV
KEAESGDQLKPGTAYLAPGGKQMMLERGGVHGRIKVLAGSADMNYKPSVDITFASASKIA
GRDTLAVVLTGMGADGREGARMLKSAGATIWAQDEASCVVYGMPQAVAAAGLSTHSIGLE
DMADAILRESGNG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggccattaaagttctcgtagtcgatgactctagtttttttcgtcgaagagtcagtgat
atagtgaataaagatcctgatttagaggtggtaggcacagctgtaaacggagctgatgca
gttaagttagtggcggaacttaagcctcaagtgatcaccatggatatcgagatgcctgtc
atggacggcatcacagctgtgcgtgagataatggccaagaatccaacaccaattattatg
ttttcatcattaactcatgatggtgcaaaagcgactctggatgccttagaagccggtgct
ttagactttttgcctaaacgtttcgaagatatcgcaaccaataaagaagatgcggttttg
ttgctgcagcaacgcataaaagccttaggtcgtcggcgtatatatagaccgctaactcga
acaagtgcaccgagtgctcctagtgcaaaagctaaattgactagtggcttatccccatcc
tctcgaacaggtagggaaactgctactagccttagaacgactactctaattcgtgcaact
ggtaaaaagtatagattgctactgattggtacctcgactggcggacctgtggctttgcag
agaattttaactaaattacctgccaattatcctcaccctattttactcattcagcatatg
cctgcggcatttacccctgcgtttgccagtaggttgaatggattatgtaaaattgaagtc
aaagaagccgaatctggcgaccaattaaaaccaggaactgcttatctcgcgccaggcgga
aagcagatgatgttagaaagaggtggagtacacggtagaattaaagtgctagctggtagt
gccgatatgaattataagcccagcgtcgatatcacttttgcctcagcgtcaaaaattgcc
ggaagagacaccttagccgtagtgttaacaggtatgggagcagacggcagagaaggtgca
cgtatgctcaaaagcgcaggagcaactatctgggctcaagatgaggcgagttgtgtggtc
tatggcatgccacaagcggtagctgctgctggtctgtcgactcattccatcggtctagaa
gatatggcggatgcaattcttcgtgagtccggtaatggctaa

DBGET integrated database retrieval system