KEGG   Shewanella violacea: SVI_1531Help
Entry
SVI_1531          CDS       T01206                                 

Gene name
galU-2
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
svo  Shewanella violacea
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SVI_1531 (galU-2)
   00052 Galactose metabolism
    SVI_1531 (galU-2)
   00500 Starch and sucrose metabolism
    SVI_1531 (galU-2)
   00520 Amino sugar and nucleotide sugar metabolism
    SVI_1531 (galU-2)
Enzymes [BR:svo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SVI_1531 (galU-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1758752..1759675)
Genome map
AA seq 307 aa AA seqDB search
MKQAQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVNEAIAAGINEIVLVTH
ASKDPIENHFDTSFELEAQLEKRVKRQLLAEVQSICPPGVTVISVRQSQAKGLGHAILCA
KPVVGDEPFAVLLPDVIVDEASCDLRKDNLAEMVNLFNQSNVGQIMVEGVPFNQVHQYGI
ADVNGNKLRPGDSAPLAQLVEKPSIEEAPSNLAIVGRYILPADIWSLLAKTPAGAGDEIQ
LTDAIAMMMEKQTVNAYYMKGKSHDCGNKLGYMQANIEHALRHKEIGQDFKQYLTKLVSE
FIEEKQS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcgcaaatacgtaaagctgtgatcccggtagcgggactaggaacaaggatg
cttcctgcgactaaggccattccaaaagagatgctacccgtcgtcgataagccgcttatt
caatatgttgtcaatgaagccatcgccgcgggtatcaatgaaattgtcctagttacccat
gccagtaaagatcccatcgagaatcatttcgataccagtttcgagctcgaagctcaacta
gagaaacgagtaaaacgccaactattagccgaggtgcaatctatctgtccccccggtgtt
actgtgatcagcgtaagacaatcccaggccaaaggtttaggccatgccattttatgcgcg
aagcctgtggtgggagatgagccctttgccgtgctcttgcccgatgttatcgtagatgaa
gccagctgcgatctgagaaaagataatctggcagagatggttaacctgttcaaccagagc
aatgtcggccagatcatggttgaaggcgtacccttcaaccaagtccatcaatacggcatt
gccgacgtcaatggcaataaactaagacccggtgattcagcacctttagctcagttggta
gagaaaccaagcatagaagaggctccatcgaacctagccatcgttggacgttacatctta
cccgcagatatttggtcattactggccaagacccctgcgggagcaggtgatgaaattcag
ctcacagatgccatcgccatgatgatggaaaagcagacggtaaatgcttattatatgaag
ggaaagagccacgattgcggcaacaagctgggatatatgcaagccaacatagagcatgcc
ctacgtcataaagagataggtcaagatttcaaacagtacctaacaaaattagtctcagaa
ttcatcgaggaaaaacagtcatga

DBGET integrated database retrieval system