KEGG   Shewanella violacea: SVI_1531Help
Entry
SVI_1531          CDS       T01206                                 

Gene name
galU-2
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
svo  Shewanella violacea
Pathway
svo00040  Pentose and glucuronate interconversions
svo00052  Galactose metabolism
svo00500  Starch and sucrose metabolism
svo00520  Amino sugar and nucleotide sugar metabolism
svo01100  Metabolic pathways
svo01130  Biosynthesis of antibiotics
Module
svo_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SVI_1531 (galU-2)
   00052 Galactose metabolism
    SVI_1531 (galU-2)
   00500 Starch and sucrose metabolism
    SVI_1531 (galU-2)
   00520 Amino sugar and nucleotide sugar metabolism
    SVI_1531 (galU-2)
Enzymes [BR:svo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SVI_1531 (galU-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: BAJ01502
UniProt: D4ZIK3
Position
complement(1758752..1759675)
Genome map
AA seq 307 aa AA seqDB search
MKQAQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVNEAIAAGINEIVLVTH
ASKDPIENHFDTSFELEAQLEKRVKRQLLAEVQSICPPGVTVISVRQSQAKGLGHAILCA
KPVVGDEPFAVLLPDVIVDEASCDLRKDNLAEMVNLFNQSNVGQIMVEGVPFNQVHQYGI
ADVNGNKLRPGDSAPLAQLVEKPSIEEAPSNLAIVGRYILPADIWSLLAKTPAGAGDEIQ
LTDAIAMMMEKQTVNAYYMKGKSHDCGNKLGYMQANIEHALRHKEIGQDFKQYLTKLVSE
FIEEKQS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcgcaaatacgtaaagctgtgatcccggtagcgggactaggaacaaggatg
cttcctgcgactaaggccattccaaaagagatgctacccgtcgtcgataagccgcttatt
caatatgttgtcaatgaagccatcgccgcgggtatcaatgaaattgtcctagttacccat
gccagtaaagatcccatcgagaatcatttcgataccagtttcgagctcgaagctcaacta
gagaaacgagtaaaacgccaactattagccgaggtgcaatctatctgtccccccggtgtt
actgtgatcagcgtaagacaatcccaggccaaaggtttaggccatgccattttatgcgcg
aagcctgtggtgggagatgagccctttgccgtgctcttgcccgatgttatcgtagatgaa
gccagctgcgatctgagaaaagataatctggcagagatggttaacctgttcaaccagagc
aatgtcggccagatcatggttgaaggcgtacccttcaaccaagtccatcaatacggcatt
gccgacgtcaatggcaataaactaagacccggtgattcagcacctttagctcagttggta
gagaaaccaagcatagaagaggctccatcgaacctagccatcgttggacgttacatctta
cccgcagatatttggtcattactggccaagacccctgcgggagcaggtgatgaaattcag
ctcacagatgccatcgccatgatgatggaaaagcagacggtaaatgcttattatatgaag
ggaaagagccacgattgcggcaacaagctgggatatatgcaagccaacatagagcatgcc
ctacgtcataaagagataggtcaagatttcaaacagtacctaacaaaattagtctcagaa
ttcatcgaggaaaaacagtcatga

DBGET integrated database retrieval system