KEGG   Shewanella violacea: SVI_1607Help
Entry
SVI_1607          CDS       T01206                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
svo  Shewanella violacea
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SVI_1607
Enzymes [BR:svo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SVI_1607
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SVI_1607
Lipid biosynthesis proteins [BR:svo01004]
 Fatty acid synthase
  Component type
   SVI_1607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1838739..1839380)
Genome map
AA seq 213 aa AA seqDB search
MIALISDIKPFYSILLRRLLTLLTLTYLFVSTQVLAAPILILGDSLSASYGIDEDKGWVN
LLRAKLPKHEIINASVSGDTSAGGLRRLPSLLESGKPKLVLIELGGNDGLRGFTPQQLKE
NLTKIIILSKQTQAQVLLSEVMVPPNYGPRYARMFADVYNQLAEEHEITLMPFFMKDIAI
YPELMQRDGIHPNAQAQMQIADFVLPWVTKILE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgatagcactgatatctgacataaaacccttctattcaatcttacttagacgcttgctg
actctgctgaccttaacctacctgttcgtaagcactcaagtattagccgctcctatatta
atcctaggagatagcttaagtgcaagctatggtatcgatgaagataaaggttgggtcaac
ttgttaagagctaaactaccaaaacatgagatcataaacgcctctgtaagcggtgacacc
tcggcgggaggattgcgtagactccccagcctgcttgaatctggtaagcctaagttggtc
ttgatcgaattgggtggcaatgacggattacgcggatttactcctcaacaactgaaagaa
aatcttacaaaaataatcatattatctaaacaaacccaggctcaagtgctcttgagtgaa
gtcatggtcccgccaaactatggccctagatatgcgcgtatgtttgccgatgtttataat
cagctggctgaggaacatgaaataacccttatgcccttctttatgaaagatatcgctatc
tatcccgaattgatgcaaagagacggaattcatcccaatgctcaagcgcagatgcagata
gccgacttcgtgctaccttgggtgactaaaattttagaataa

DBGET integrated database retrieval system