KEGG   Shewanella violacea: SVI_1775Help
Entry
SVI_1775          CDS       T01206                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
svo  Shewanella violacea
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:svo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2036521..2038209)
Genome map
AA seq 562 aa AA seqDB search
MCSIFAILDIKSDATQLRQVALEMSKLMRHRGPDWSGIYSCDKAVLAHERLAIVDIDNGA
QPLLSSDGNIILAVNGEIYNHKELKAELGDKYAYQTNSDCEVILSLYQEYGVDFLDKLNG
IFAFVLYDKTKDLYLVGRDHMGIIPLYTGLDTEGNFYIASEMKALMPVCKTVDVFKPGHY
LCNQATGTEDGYVQYYQRDWREFSAVQDNPASIDEIRDALEAAVKRQLMSDVPYGVLLSG
GLDSSVISAITQTFAKRRIEDDGESNAWWPQLHSFAVGLEGAPDLIAAKKVAKAIGTIHH
EITFTFQDGIDAIKDVIYHLETYDITTIRSATPMYLMARKIKAMGIKMVLSGEGADELFG
GYLYFHKAPNAQAFHEELVRKLDKLFMFDCLRANKAMAAWGLEARVPFLDKEFMDVAMRI
NPEAKMSKDGRIEKHILRQAFEHKLPKEVTWRQKEQFSDGVGYSWIDGLKELAAEKVDDL
QLANAKFKFPYNTPDTKEGYYYRCFFEELFPLDTAAKTVPGGKSVACSTPEALAWDKSLQ
GIIDPSGRAVQSVHDSAYSTSD
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatttttgccattttagatattaagtcagacgcaacacagctgcgacaggtc
gcactggaaatgtctaagttgatgcgtcaccgtggaccggattggtcagggatctacagc
tgcgataaagccgttttagctcacgagcgcctcgccatcgttgatatcgataacggtgct
caacctctattaagcagcgatggcaacataattcttgcggtcaacggtgagatctacaac
cacaaagaacttaaggccgagctaggcgataagtacgcttaccaaactaactccgactgt
gaagtgatcctatccctttatcaagaatatggtgtggacttccttgataagttgaacggc
atatttgccttcgtactttacgataagactaaagacctgtatctagttggccgagatcat
atgggtatcattcctctctacacaggcttagacactgaaggtaacttctacattgcctca
gaaatgaaagccttgatgccagtgtgtaaaacagtcgatgtatttaagccgggccattac
ttgtgtaaccaagcgaccggcaccgaagacggttatgtgcaatattatcaacgtgactgg
cgcgagttttcagcggtacaagataacccagccagtatcgacgaaataagagatgcactg
gaagccgcggttaagcgtcagctgatgtctgatgttccttacggtgtactgctatcgggt
ggtctggattcatcggttatctcagctatcacgcaaacttttgctaaacgccgtatcgaa
gatgatggcgagagcaatgcatggtggccacagcttcactcttttgccgttggccttgaa
ggtgccccagatttgattgcggcaaaaaaagtcgccaaggccatagggacaatccatcat
gagatcacctttaccttccaagatggtatcgatgcgattaaagatgtaatttaccatctt
gaaacctatgacattactactattcgttctgctacacctatgtacctaatggcaagaaaa
attaaagctatgggtatcaagatggtgttatcaggtgaaggtgccgatgaattatttggt
ggctatttatacttccataaggccccaaatgcacaggccttccatgaagagttagtgcgt
aaactggacaagctgttcatgtttgattgtcttcgagccaacaaggcgatggcagcatgg
ggacttgaggcacgtgtgcccttcctggataaagaattcatggatgtggcaatgcgcatc
aatccggaagctaagatgtctaaagatggccgtatcgaaaagcatattctgcgccaggct
ttcgagcacaagttgcccaaagaagttacttggcgtcagaaggagcagttcagtgatggt
gtaggctactcatggatcgatggtttgaaggagctggcagccgagaaagtcgatgacctg
caactggccaatgctaagtttaagttcccctacaacacgcctgataccaaagaaggctac
tattatcgttgtttcttcgaggagctatttcctctggacacggcagctaaaacggttcct
ggcggcaagtcggtagcttgttcgactccagaagcacttgcttgggataagagccttcag
ggtatcattgacccatcgggacgtgcggtacagtcggttcacgatagcgcttattcaacc
tctgattga

DBGET integrated database retrieval system