KEGG   Shewanella violacea: SVI_1842Help
Entry
SVI_1842          CDS       T01206                                 

Definition
(GenBank) GGDEF domain protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
svo  Shewanella violacea
Brite
Enzymes [BR:svo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     SVI_1842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2118113..2119138)
Genome map
AA seq 341 aa AA seqDB search
MSKEIIKLAARNLKKAVPLMLKHQIPTTPTNYALWYTYVSEQSPELNKRLDTVIEQHHTC
PPVNAEMLYREYVSDPIEVDVLDMRQNLEAMVTELSHSLKDTNVDATQFQRRIDSNFDKL
NRIEEEGVSLEKVLGIVRSLVKESDDIRSSTQYFTGQLSKAQQEINALKQQLEKSEQIML
YDALTGIFNRRAFDNDLRGSLSQSPDGLCLILADIDHFKEFNDNYGHQLGDQVLKVVAKR
LQASCRDGAKLYRYGGEEFAVIIPKSQLGSSRHLAEAMRRGLEKITLKDRRKDVRINKIT
ASFGVAQWNKNLEGAELIEQADKLLYEAKRLGRNRVMPIPS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaatcataaagctggcggccagaaacttaaaaaaagccgttcctttaatg
ttaaagcaccaaattcctaccacgccaaccaattatgcgctctggtatacctatgtctca
gaacaaagtccggaattaaacaaacgactcgacacggttattgagcaacatcatacctgc
ccgcccgtgaatgctgagatgctatatcgagaatacgtgtcagatcctatcgaggtcgat
gtcctcgacatgcgacagaatctagaagccatggtcactgagctctctcactctctcaaa
gataccaatgttgatgccacacaatttcagcgccgtatcgacagtaatttcgataaatta
aatcgaatcgaagaggaaggcgtcagcttagagaaggtactcggtatcgtcagaagctta
gtcaaggagtccgacgacatacgttccagcacacagtatttcaccggtcaactgagtaaa
gcccaacaagagatcaatgctttaaagcagcaattagaaaaatctgaacaaatcatgcta
tacgatgccctcacaggtatattcaatcgccgcgcattcgataatgatcttagaggctcc
ctgagccaatcacctgacggtttatgcctcatactcgcggatatcgaccatttcaaagaa
tttaatgataactatggtcatcagctaggcgatcaagtacttaaagtggtcgctaagcga
ctacaggcatcctgtagagacggcgctaaactctatcgatatggcggcgaagaatttgct
gtcatcatacctaagagccaacttggttcttcccgacatttggccgaagccatgcgccgt
gggctggaaaaaataaccctaaaagacagaaggaaagatgttcgtatcaataagatcacc
gcatcattcggcgtcgcacaatggaataaaaacctcgagggcgccgagcttatagagcaa
gcggacaaacttctctacgaggcaaaacgcctaggccgaaacagggtcatgccgatcccc
agctaa

DBGET integrated database retrieval system