KEGG   Shewanella violacea: SVI_1842Help
Entry
SVI_1842          CDS       T01206                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
svo  Shewanella violacea
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2118113..2119138)
Genome map
AA seq 341 aa AA seqDB search
MSKEIIKLAARNLKKAVPLMLKHQIPTTPTNYALWYTYVSEQSPELNKRLDTVIEQHHTC
PPVNAEMLYREYVSDPIEVDVLDMRQNLEAMVTELSHSLKDTNVDATQFQRRIDSNFDKL
NRIEEEGVSLEKVLGIVRSLVKESDDIRSSTQYFTGQLSKAQQEINALKQQLEKSEQIML
YDALTGIFNRRAFDNDLRGSLSQSPDGLCLILADIDHFKEFNDNYGHQLGDQVLKVVAKR
LQASCRDGAKLYRYGGEEFAVIIPKSQLGSSRHLAEAMRRGLEKITLKDRRKDVRINKIT
ASFGVAQWNKNLEGAELIEQADKLLYEAKRLGRNRVMPIPS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaatcataaagctggcggccagaaacttaaaaaaagccgttcctttaatg
ttaaagcaccaaattcctaccacgccaaccaattatgcgctctggtatacctatgtctca
gaacaaagtccggaattaaacaaacgactcgacacggttattgagcaacatcatacctgc
ccgcccgtgaatgctgagatgctatatcgagaatacgtgtcagatcctatcgaggtcgat
gtcctcgacatgcgacagaatctagaagccatggtcactgagctctctcactctctcaaa
gataccaatgttgatgccacacaatttcagcgccgtatcgacagtaatttcgataaatta
aatcgaatcgaagaggaaggcgtcagcttagagaaggtactcggtatcgtcagaagctta
gtcaaggagtccgacgacatacgttccagcacacagtatttcaccggtcaactgagtaaa
gcccaacaagagatcaatgctttaaagcagcaattagaaaaatctgaacaaatcatgcta
tacgatgccctcacaggtatattcaatcgccgcgcattcgataatgatcttagaggctcc
ctgagccaatcacctgacggtttatgcctcatactcgcggatatcgaccatttcaaagaa
tttaatgataactatggtcatcagctaggcgatcaagtacttaaagtggtcgctaagcga
ctacaggcatcctgtagagacggcgctaaactctatcgatatggcggcgaagaatttgct
gtcatcatacctaagagccaacttggttcttcccgacatttggccgaagccatgcgccgt
gggctggaaaaaataaccctaaaagacagaaggaaagatgttcgtatcaataagatcacc
gcatcattcggcgtcgcacaatggaataaaaacctcgagggcgccgagcttatagagcaa
gcggacaaacttctctacgaggcaaaacgcctaggccgaaacagggtcatgccgatcccc
agctaa

DBGET integrated database retrieval system