KEGG   Shewanella violacea: SVI_1934Help
Entry
SVI_1934          CDS       T01206                                 

Definition
arsenate reductase family protein
Organism
svo  Shewanella violacea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2220497..2220841)
Genome map
AA seq 114 aa AA seqDB search
MILYGIKNCDTVRKARKWLQANQAQVTFHDFREDGLDKDQLTSWVAMAGWETLFNKRSTS
FRNLSDADKSDIDQDKAIELMLAHPTLIKRPVLVAADKVQVGFKEAEYQAWFNL
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
ttgatcctctacggcataaaaaactgcgatacagtacgtaaagccagaaaatggcttcag
gctaaccaagctcaagtgacttttcatgactttcgtgaagatggactcgacaaagaccag
ctcactagctgggttgccatggcgggctgggaaactctgttcaacaaacgcagcaccagc
tttagaaacttgtccgatgccgacaagtctgatatcgatcaggacaaggccatcgaactg
atgcttgcccatccgacgctgatcaagagacccgtattagttgctgccgataaagtgcag
gtaggatttaaagaagccgaatatcaagcctggtttaacctatga

DBGET integrated database retrieval system