KEGG   Shewanella violacea: SVI_2023Help
Entry
SVI_2023          CDS       T01206                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
svo  Shewanella violacea
Pathway
svo00620  Pyruvate metabolism
svo00630  Glyoxylate and dicarboxylate metabolism
svo01100  Metabolic pathways
svo01110  Biosynthesis of secondary metabolites
svo01120  Microbial metabolism in diverse environments
svo01200  Carbon metabolism
Module
svo_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SVI_2023 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    SVI_2023 (glcB)
Enzymes [BR:svo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SVI_2023 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: BAJ01994
UniProt: D4ZJZ5
Position
2328659..2330827
Genome map
AA seq 722 aa AA seqDB search
MTSRIQVGNLQVATSLFELVNQQMIPGTDISSERFWISLESIIDDLTPKNRDLLARRDEL
QAQIDKWHTEHKVHDPLAYKAFLQQIGYLVTEGEDFTITTENVDIEIALQAGPQLVVPVK
NARFALNAANARWGSLYDALYGTDAISEAGGAEIGSGFNPVRGSKVIAFAKQHLDQLAPL
AIGSHSEVSHYQIDRDQLVITLSDGTDTQLKQPGKLVGYLGNLVAPHAILLKNNGLHVEI
QIDRNHSIGKTDLAGMKDLLVEAAVTTIMDCEDSVAAVDAEDKCEVYQNWLGLMKGDLTA
QLIKGGKTITRELNLDRRYLSVQGREFTLPGRSLLFIRNVGHLMTNDAILDKAGDEIPEG
ILDGMVSVLAALHDLKGNNKQRTNSRAGSINIVKPKMHGPDEVAFTCELFSRIEDALSLS
RNTIKLGIMDEERRTTVNLKECIRVAKERVVFINTGFLDRTGDEIHTSMLAGPFVPKTLM
KQQAWIKAYEDWNVDVGLACGLPGRAQIGKGMWAMPDEMAAMLAQKTAHPNAGANTAWVP
SPNGAILHSTHYHQINVAEKQQELSNRPHAKLDDILTIPLLSQSLTDEEIQRELDNNAQG
ILGYVVRWIDSGVGCSKVPDINNVGLMEDRATLRISSQYIANWLEHKICTQAQVIASMKR
MAAVVDKQNAGDGLYHKMAPDFSGIAFNAALDLVFKGKDQPSGYTEPLLHAYRIKKKAEQ
TQ
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgacatcacgtattcaagttggcaatttacaggtcgctacctcactgttcgagttagtc
aatcagcagatgatccccggaaccgacatttcatcggaacgcttttggatctcacttgaa
tccattattgatgatctaaccccaaagaacagagacttattagcccgtcgtgatgagtta
caagctcagatagacaagtggcatacagaacataaggtccatgaccctctggcctataag
gcatttttgcaacagataggttatctggttaccgaaggtgaggatttcaccatcaccaca
gaaaatgttgatattgaaattgctctgcaggctggacctcagcttgttgtcccggttaaa
aatgcccgttttgcccttaatgctgctaacgcgcgttgggggagcttatatgatgcactt
tatggtaccgatgccatcagtgaagctgggggcgccgagattggtagtggttttaatcca
gtacgtggcagtaaggtcatagcgtttgccaagcagcatttagaccaactggctccttta
gcaattggcagccatagcgaggtaagccattatcaaattgatcgagaccagctagtaatc
accctaagcgatggcacagatactcaacttaaacagcctggaaaattggtgggatatctg
ggaaatctggtggcgccacatgccattttactgaagaataatggtttgcatgttgagatt
cagatagacagaaatcactccataggcaagacagatctggcgggcatgaaagacctactg
gtagaagctgctgtaaccaccatcatggattgtgaagactcggtggctgctgtcgatgca
gaagacaagtgtgaggtctatcaaaactggttaggcttgatgaaaggtgatctcaccgcc
cagttaatcaaaggcggtaagacaataacccgagaactcaatctagatcgtcgttatttg
tctgttcaggggcgggagtttacgctgccaggtcgaagtctgttgtttattcgtaatgtt
ggccacctgatgactaatgatgccattttagacaaggcgggtgacgagatccctgagggg
atcttagatggtatggtatcggtattggcggccttgcacgatcttaagggcaataataag
caacgcactaatagccgagcgggttcgattaatattgttaaacctaaaatgcatggaccc
gatgaggtggcatttacctgtgagctgtttagccgtatcgaagatgcactcagtctctcc
agaaataccatcaaacttgggatcatggatgaagagcgcaggacaacggtgaacttgaaa
gaatgtattcgcgtggctaaggagagagtggtgtttattaacacaggatttctcgataga
accggcgatgagatccacacttctatgttagccggcccctttgtacctaaaacactgatg
aagcaacaagcctggattaaggcctatgaggattggaatgtcgatgtaggactggcatgt
ggcttacccggccgtgctcagataggtaagggcatgtgggccatgcctgatgagatggcg
gccatgcttgcgcaaaaaacggctcatcccaatgcaggggctaatacggcctgggtacca
tctcccaatggcgccatactgcattcaacacattatcatcaaattaatgtcgccgagaaa
caacaagaattgtctaacagaccccatgcaaaattagatgacatcttgacgatccccttg
ttgtcacaaagcttaaccgatgaagagatccaacgtgaactggacaacaatgcccagggg
atcttaggttacgtggtacgttggatagatagtggggttggctgttccaaagtgcctgat
atcaacaacgtgggactaatggaagatagagcgaccttgagaatatcatcacaatatatc
gccaattggcttgagcataagatctgtacccaggcgcaagttatcgcttccatgaagaga
atggctgcggttgttgataaacaaaatgccggtgatggcctctatcacaagatggcacca
gatttcagtggcatcgcctttaacgcggcgcttgatctggtgtttaaaggaaaggatcag
ccatcgggttacactgaacccttgctccatgcttatcgtattaaaaagaaggcagagcaa
actcaataa

DBGET integrated database retrieval system