KEGG   Shewanella violacea: SVI_2310Help
Entry
SVI_2310          CDS       T01206                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
svo  Shewanella violacea
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2645976..2647106)
Genome map
AA seq 376 aa AA seqDB search
MLVTKYYSIVSGSSALTRSIQNFTNNYSQGGGSMNLAKHLTDIELSAKILRHAVPKMSEL
NIPVTPVNYAVWYEYYLGINLDLKRAIDGLISNGITFCTEVNDGLHQNFIQEKSPEVIEN
VQIETQIIINSLLNKVSKLTQGTANFSNTLSDFSQELKQKPDVEVLNTLINSLVDNIEGV
VLSNKQMQGSLNIMRDEVSSLKSEMENLNLVAMTDQLTSLNNRRSFEDEVMKHMQKYTQS
QSPSCMLLIDIDHFKRFNDAHGHLVGDKVLAYVALALKQVVKGTDFVARYGGEEFVILLP
NTQLTDALVVAEQLRTAISERKLTLGKDKKLSLGSITVSLGVSTLNIGDNRESYFVRADE
ALYRAKSSGRNCVCSE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttgttagtcactaagtattactcaattgtgagtgggtcctcagcgctaacgagatccata
cagaattttactaacaattattcacagggcggtggaagcatgaatttagcgaaacacctg
acagatatcgaattgtctgcaaaaatccttaggcatgcagtgcctaaaatgtctgaactc
aatattcccgtcacaccggtcaattacgctgtttggtatgaatattatctggggattaat
ttagaccttaaacgtgccatcgatggtcttatctcaaacggtattacgttttgtacggaa
gtgaatgatgggcttcaccagaattttattcaagaaaaatcaccggaagtgatcgagaac
gtccaaattgaaactcaaatcatcattaatagtttactgaacaaagtcagtaagttgact
caaggtacagctaacttttccaacactttatctgattttagccaagagctgaaacaaaaa
cccgatgtcgaagtacttaacacacttatcaatagcctagtcgataatatagaaggcgtg
gtgttaagtaataagcagatgcagggcagcttaaatatcatgcgtgatgaggtgagttcg
ctaaaaagcgagatggaaaacttaaacctggtggccatgacagatcaactgacatcactc
aataatcggcgtagtttcgaggatgaagtgatgaagcacatgcaaaaatatactcaatct
cagtctccaagttgtatgctcttgatagatatcgatcattttaaacggtttaatgatgct
catggtcacttagtcggggataaagtgcttgcctatgtggcattagccttgaaacaagtg
gtgaaggggaccgattttgttgctcgttatggaggcgaagaatttgttatcttgctacct
aatacacagctaacagatgcattggttgtggccgagcagctacgtacagcgatatctgag
cgtaaattaaccttaggcaaggataagaaattgtctttgggttccattaccgtatcgttg
ggagtatcgactcttaatattggtgacaatcgagaaagctattttgtcagggccgatgaa
gcactttatcgcgctaagtcgtcgggaagaaactgtgtttgtagtgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system