KEGG   Shewanella violacea: SVI_2409Help
Entry
SVI_2409          CDS       T01206                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
svo  Shewanella violacea
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:svo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SVI_2409 (recD)
Enzymes [BR:svo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SVI_2409 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2765980..2768091
Genome map
AA seq 703 aa AA seqDB search
MIQSRLPIKNLLKSWETERLITPLDRHFALELAEFHRPQLNQHSESHNELFLLICALLSH
QLSQQHTCLPIEQILLNNPMNEQTAQCEITCSHAELMALLSQFSAIGVPLDSMPQNSLPR
DSVPQESVAQDNVPLDNVPQESVAQDGVAENSSTPLVLDQGSLYLQRYYQFETQVADKLR
HLAQGEIQELPTATQDTLNILFPHNPQKNAATESPVHDWQKIATATAFTKRLAVITGGPG
TGKTTTVTKLLFLMTQEAELIIKLVAPTGKAAARLSESIKASKVRLKSELAPFADSIDVN
SLSRVPEEASTLHRLLGVIPNSPQFRHHKDNPLRLDLLVVDEASMVDLPMMHKLLSALPD
HARLILLGDQDQLASVEAGAVLADICAGLKADKSQSAKWQMRYSAAYAQRLSQLTGNDLS
GFISASPGIGDSLCMLMHSHRFKGDAGIGQLATAVNNSDKSRIMEVWQSGYDELYWIEHQ
KTHTGNTGLELLLAQSVDHYRAYLELANQPQSTPLDIIECYNEFRILCAMRAGEYGVDGI
NQGVRDALKQAKLISPEHEFYPGRPVIIQSNDYNLGLFNGDIGLILPDSATQQATHSAPR
LMAHFIQADGSILKVLPARLPSHDTCFAMTVHKSQGSEFSKVAMVLPLWPSQAQKQLLTK
ELVYTAITRAKHHFTCLGSQTVFEQASLQATKRSSGLARRLWN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgatccagtcaaggctaccgataaaaaacttgctcaaatcatgggaaaccgagcgactc
atcacaccactggaccgtcattttgcactcgagttggctgagtttcatcgaccacagctt
aaccaacacagtgagtcccacaatgagttatttctcctcatctgtgccttgctcagtcat
cagctttcccagcagcacacttgcttacccatagagcaaatcttgctgaataaccccatg
aacgagcagacagcccagtgtgaaatcacctgtagtcacgccgaacttatggccttattg
agtcagttcagtgctatcggtgtgcctctagatagcatgcctcaaaatagcttgcctcga
gatagtgtgcctcaagaaagcgtggcccaagataacgtgcctctagataacgtacctcaa
gaaagcgtggcccaagacggcgtagctgaaaacagttcgacgcctctggtattagatcaa
ggctccctctacctgcagcgctattatcaatttgagactcaggtggccgacaagctaaga
caccttgcccaaggtgagatccaagagcttccaacagccacccaagacaccttaaacata
ctgtttccccacaatccccaaaaaaatgcggccacagaatcaccagtgcatgattggcag
aagatagccacggccacggccttcaccaaacgcctagcggtaataaccggcgggccgggc
acaggtaaaaccaccacagtcaccaagctactgtttctaatgacccaggaagccgagctg
atcataaagctggtggccccaactggcaaagcggccgccagactcagtgagtcaatcaag
gcctctaaggtgcgattaaaatctgagcttgcccccttcgccgacagcatagatgtcaat
agcttaagccgggtccccgaggaagcatcgactctgcacaggttactgggcgtgatccct
aactcaccgcaatttcgccatcataaggataatcctctcaggctggatctgttagtggtc
gatgaagcctctatggtcgatctccccatgatgcacaagttactgtcggccttgccagac
catgccaggcttatcttgctgggcgatcaagaccagctggcctcagtcgaggctggcgcc
gtacttgcagacatctgcgccggactcaaggcagataagagccaatcggcaaagtggcag
atgcgttactcggctgcttatgcccaacgattatctcaactaacaggcaatgatttaagt
ggctttatcagcgcatccccaggcataggtgacagtttatgcatgttgatgcacagccat
agatttaagggtgatgcgggtataggtcagttagcgactgcggtaaataactctgacaag
tcacgcatcatggaggtgtggcaatcaggctacgatgagctttactggattgaacatcaa
aaaacacacacaggtaatactgggctagagctgttactggctcagtcggtggatcactac
cgggcttatctggagctggctaaccagccgcaaagtactcctctggatatcatagagtgt
tacaacgagttccgaattctgtgcgccatgcgcgcgggcgaatacggcgtcgatggcatc
aatcagggagtcagagacgccttgaagcaggccaaactaatctcgccagaacacgagttc
tacccgggacgcccggttatcatacagagcaatgattataacttaggcctgtttaacggt
gatatcggcctcatcttacccgatagcgccacacagcaggcgacccactcagcccctcgc
ttgatggctcactttatccaagctgatggcagtatcttaaaggtgctccccgctcgtctg
ccgagccacgacacctgttttgccatgacggtacataagagccaaggcagtgagtttagc
aaggtcgccatggtgctacctctctggcctagtcaggcgcagaaacagttactcaccaag
gagctggtgtatacggccatcacccgagccaagcatcactttacctgtttggggagtcaa
accgtcttcgagcaggccagcctacaggctaccaagcgatcatctggactggcgaggcga
ctatggaactag

DBGET integrated database retrieval system