KEGG   Shewanella violacea: SVI_2733Help
Entry
SVI_2733          CDS       T01206                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
svo  Shewanella violacea
Pathway
svo00020  Citrate cycle (TCA cycle)
svo00640  Propanoate metabolism
svo00660  C5-Branched dibasic acid metabolism
svo01100  Metabolic pathways
svo01110  Biosynthesis of secondary metabolites
svo01120  Microbial metabolism in diverse environments
svo01130  Biosynthesis of antibiotics
svo01200  Carbon metabolism
Module
svo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
svo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SVI_2733 (sucC)
   00640 Propanoate metabolism
    SVI_2733 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SVI_2733 (sucC)
Enzymes [BR:svo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SVI_2733 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A NUC153
Motif
Other DBs
NCBI-ProteinID: BAJ02704
UniProt: D4ZM05
Position
complement(3096444..3097610)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKALFAEYGLPVSEGFACDTAQEAVEAAGHIGGDMWVVKCQVHAGGRGKAGGV
KVTGSKDEIRAFAEHWLGKNLVTYQTDAKGQPVAKILVESCTDIANELYLGAVVDRASRR
VVFMASTEGGVDIETVAENTPELIHKAIIDPLTGPQPFQARDLGFKLGLNPTQMKQFTKV
FMGLAKMFEDHDFALLEINPLVITTEGNIHCLDGKIGIDGNALYRQPKIRDMHDPSQDDA
REAHAAKFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGNPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVTVPVVVRLEGTNAELGREV
LAGSDLDIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaagctctttttgccgaatatggtttaccagtgtca
gaaggttttgcatgtgatacagctcaagaagctgtagaagctgctggccatattggcggt
gatatgtgggttgttaagtgtcaagtacacgcaggcggccgtggtaaagcgggtggcgtt
aaagttactggttctaaagacgagatcagagcgtttgccgaacattggttaggtaaaaat
ctggtgacttaccagacagatgcgaagggtcagccagtagctaaaattttagtagaaagc
tgcaccgatatcgccaacgaattgtacctaggtgccgttgtcgatcgtgcttcacgtcgt
gtggtattcatggcttctaccgaaggtggtgtggatattgagactgtggctgaaaatacg
cctgagttgatccacaaggccatcatagatccattgacaggtcctcagccattccaggca
cgtgatcttggcttcaagttgggtctaaacccgactcagatgaagcagttcactaaagtc
ttcatgggcttagctaagatgttcgaagaccatgatttcgcacttctagagattaacccg
ctagttattaccaccgaaggcaacattcactgtctcgacggtaaaattggcatcgatggt
aacgctttgtaccgtcagcctaaaatccgtgacatgcacgatccatcacaagatgatgct
cgtgaagcacatgctgctaagttcgagcttaactatgtagcactagacggaaacgtcggc
tgtatggttaacggcgcgggtcttgctatgggaactatggatatagttaacctacacggc
ggcaatccagctaacttccttgatgttggcggcggagcgactaaagagcgcgttgctgaa
gcgttcaagatcatcctatctgacgataacgttaaagcagtattggttaacatcttcggt
ggtatcgtgcgttgtgacatgatagctgaaggtattatcggtgcggttaaagaggtcggt
gtaaccgttcctgttgttgttcgtcttgaaggtactaacgcagagcttggccgtgaagtt
ttggctggttcagatctcgatatcatcgctgccacgagtcttacagacgcggctcagcaa
gttgttaaagctgcggagggcaaataa

DBGET integrated database retrieval system