KEGG   Shewanella violacea: SVI_2734Help
Entry
SVI_2734          CDS       T01206                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
svo  Shewanella violacea
Pathway
svo00020  Citrate cycle (TCA cycle)
svo00310  Lysine degradation
svo01100  Metabolic pathways
svo01110  Biosynthesis of secondary metabolites
svo01120  Microbial metabolism in diverse environments
svo01130  Biosynthesis of antibiotics
svo01200  Carbon metabolism
Module
svo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
svo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SVI_2734 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SVI_2734 (sucB)
Enzymes [BR:svo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SVI_2734 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: BAJ02705
UniProt: D4ZM06
Position
complement(3097722..3098912)
Genome map
AA seq 396 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKAGEQVTRDQNLVDIETDKVVLEVVAPEDGSIAEFL
AEEGDTVLGEAVIAKFIAGVVAGQEVTKAEAEAVTPEATDESNDALSPSVRRLIAEHNLD
ATKLKGTGVGGRITKEDVEAFVKSAKATPAPVASAPAAVAPLAERSEKRVPMSRLRKTIA
RRLLEAKNSTAMLTTFNEVNMQPIKDIRKQYQEVFEKRHGVRLGFMSFYIKAVTEALKRF
PEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPILRDTDTMSLADIERNVRALAIKGRDG
KLTVEDMTGGNFTITNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMMY
LALSYDHRIIDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaattaaggtacccgtactgccagaatctgttgccgatgcgaccattgcc
acttggcatgtgaaagctggcgaacaagtcactcgagatcagaacctcgtcgatatcgag
actgataaagttgtactcgaagtggttgcacctgaagatggttcaatcgctgagtttttg
gctgaagagggcgacactgttttgggtgaagccgttattgccaagtttatcgctggtgta
gttgccggtcaggaagtgactaaggccgaagctgaagccgtaacgcctgaagcgacagat
gagtcaaatgatgcactaagcccatcggttcgtcgtcttatcgccgaacataacctggat
gccactaaacttaaaggcacaggcgttggcggacgtatcactaaggaagatgttgaagcc
ttcgttaaaagtgcaaaagcgacaccggctccagtggccagtgctcctgctgccgtagcg
cctctggctgaacgaagcgagaagcgtgtgcctatgtcacgcctacgcaagacgattgct
agacgtcttctggaagctaaaaactctaccgctatgctgactacgtttaacgaagtcaac
atgcagcctattaaagatatccgtaagcagtatcaggaagtcttcgagaagcgtcatggc
gtgcgtctaggtttcatgtctttctacatcaaggccgtgaccgaagcactgaagcgcttc
cctgaagttaatgcctctatcgatggcgatgacatcgtttatcacaattatttcgatatc
agtattgcggtttctactcctcgtggtctggttacgccgatattgcgtgataccgacacc
atgagccttgccgatatcgagcgtaatgtacgtgcattggcgatcaagggccgtgacggc
aaactaaccgttgaagatatgacgggtggtaacttcaccatcactaacggtggtgtgttc
ggttcattgatgtctacaccaattttgaacctgccacagagcgcgatcttgggcatgcat
gccatcaaggatcgtccaatggcagtcaatggtcaggttgaaatcctacccatgatgtac
ctagcactttcttacgaccaccgtattatcgatggtcgtgagtcagttggcttcttggtt
gccattaaggacttcctcgaagatccaactcgtctactgttagatttataa

DBGET integrated database retrieval system