KEGG   Shewanella violacea: SVI_2806Help
Entry
SVI_2806          CDS       T01206                                 

Gene name
trpCF
Definition
tryptophan biosynthesis protein trpCF
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
svo  Shewanella violacea
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:svo01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:svo00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3179658..3181229
Genome map
AA seq 523 aa AA seqDB search
MPVVRPTAYSNSLPAPVLQPSQMKNRIRSKSVSSSIADIKTNGKENSHGQQQVTKTSNVL
AKIVATKPAHIAALKLRFPEASLEPKISDRSLYAALRAPNAGFIFECKKASPSKGLIRTD
FDVEAIADVYNDYAAGISVLTDEQFFQGNMDYIPKVRARVKQPILCKDFFVDSYQVKLAA
HQGADAILLMLSVLDDTRYSALAFEANKYQLDILTEVSNEAELVRAIALDANIIGINNRN
LRDLTTDLATTEELAPRIPADRVVISESGIYNQAQVHRLSPLVHGFLVGSSLMAEDDLDL
ACRTLTLGHNKVCGLTSVEDANAVANAGAIYGGLIFAEKSPRYITPKQAKSLLETHRSSG
KQLKFVGVFVNESVKVIAELASSLDLFAVQLHGNESEYDIAQVRGALEAAGCKAKIWKAV
AVNVDEDDTELAVPTNADRILFDSKSHKASGAQFGGTGLSFDWQQSLPNKQDAMLAGGLD
ADNASDASKQGFYGLDFNSGLESAPGRKDHHKIAAAFSALRQY
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
ttgccagtggtaaggcctacagcttactcgaacagcttgccggcgccagtactgcagcca
agtcaaatgaaaaacaggattaggagcaagagcgtgagcagttcaatagcagatattaaa
acaaacggtaaagaaaacagccatggccaacagcaagtgactaagacctctaatgtgttg
gctaagatagtcgccactaaacctgcgcatatagcagcattaaagctacgctttcccgaa
gctagcctagagcctaagatctctgaccgcagcctttatgcagcgctcagagccccaaat
gccggttttatcttcgagtgcaagaaagccagcccatccaaaggccttatccgcaccgat
tttgatgtcgaagccattgccgatgtctacaatgactacgccgcagggatctcggtgctc
acagatgagcagttttttcagggcaacatggattacattcctaaagtccgagcccgggtt
aaacagcctatcctctgtaaagacttcttcgtcgacagctatcaagttaagctcgccgcc
caccaaggcgcagatgccattcttttgatgctgtcagtgctcgatgataccagatactca
gccctagcctttgaggctaataagtaccagctcgacatactcacagaagtaagcaatgaa
gccgagctcgtgcgcgccattgcactggatgccaacatcataggcatcaataaccgtaac
ctgcgagacttgaccacagacttggccacgactgaggagctagcgccacgtatccctgcg
gatcgcgtggtgatcagcgaatcgggcatttacaatcaagctcaggttcaccgtctgagt
ccattggtccatggtttcttggttggcagctcattgatggcagaagatgatttagacctg
gcttgtcgtacattgacccttggtcataacaaggtctgcggcctgacatccgttgaagat
gccaacgccgtcgccaatgccggcgccatttatggcggactcattttcgccgagaagtca
cctcgctatatcacgccaaagcaggctaaatctctgctagaaactcatcgttcctcgggc
aagcagctcaagtttgtcggtgtgtttgttaacgaatcagtaaaggttatcgccgaactc
gcgtcatcactggatctttttgcggttcagctccacggcaatgaatctgaatatgatatc
gcccaagtgcgtggcgccttagaagctgcgggctgtaaggctaaaatttggaaagccgtg
gcggttaatgtcgatgaagatgacaccgaattagcggtgccaactaacgcagatcgcatc
ttgttcgacagtaagagccacaaagcaagtggcgcacaatttggtggtactggccttagc
ttcgattggcaacaatccctgccaaataagcaagacgccatgctcgccggtggcttagat
gccgacaatgccagtgatgcaagtaaacaaggattttacggtctggatttcaactccggc
ctagagagcgcacctgggcggaaagatcatcacaagatcgccgccgcatttagcgcactc
agacagtactaa

DBGET integrated database retrieval system