KEGG   Shewanella violacea: SVI_2807Help
Entry
SVI_2807          CDS       T01206                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
svo  Shewanella violacea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SVI_2807 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SVI_2807 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SVI_2807 (trpB)
Enzymes [BR:svo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SVI_2807 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3181436..3182662
Genome map
AA seq 408 aa AA seqDB search
MTKLDPYFGEYGGMYVPQILVPALKQLETAFIEAQEDEAFQAEFSDLLKNYAGRPTALTL
TRNLSPNPLVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
ACALLGLKCKVYMGAKDIERQSPNVFRMKLMGAEVIPVTSGSSTLKDACNEAMRDWSGSY
EKAHYLLGTAAGPHPFPTIVREFQRMIGEETKKQLFEREGCLPDAVIACVGGGSNAIGMF
ADFIDEESVQLIGVEPAGLGIDTPMHGAPLKHGKTGIFFGMKAPLMQDSEGQIQESYSIS
AGLDFPSVGPQHAHLAATGRATYESATDDEALDAFQLLARCEGIIPALESSHAIAYALKF
AEKATKETILVVNLSGRGDKDIFTVADILEKREKAQLTADKESGDDRI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactcgacccctacttcggcgaatatggcggtatgtacgtaccgcagatatta
gtgcctgcactgaaacagctagaaaccgcgtttattgaagctcaagaagatgaggccttt
caagccgaattcagcgacctgttgaaaaactatgccggtcgtccgacggcgctgaccttg
acccgtaacttgagtccgaacccactggtaaaaatctacctcaagcgtgaagacttgctt
cacggaggtgctcacaagaccaaccaggtcttaggccaggccctgcttgccaagcgcatg
ggtaagaaagagatcatcgccgaaactggcgcgggtcaacacggtgtagcaaccgctctc
gcctgtgccctgttaggccttaagtgcaaggtctacatgggcgctaaagacatagaacgt
cagtctcctaacgtgtttagaatgaagctaatgggcgcggaagtgattccggtcacctct
ggttcatcgacccttaaagatgcctgtaacgaagccatgcgcgactggtctggtagctat
gaaaaagctcactatctgctgggtactgccgcaggcccacatcccttccccactatagtg
cgtgaatttcagcgcatgataggcgaagagactaagaagcagctgtttgaacgtgaaggt
tgtctgcccgacgcagttatcgcctgtgtcggtggtggctcgaacgccatcggcatgttt
gccgacttcatcgatgaggaaagcgtacaacttatcggtgttgagcctgctggcctaggt
atcgatactcctatgcatggtgcgccccttaaacacggcaagacaggtatcttcttcggc
atgaaagcgccactgatgcaggacagcgaaggtcagatccaggagtcttactctatatcg
gcaggactcgacttcccatctgtgggtcctcagcatgcacatcttgcggctactggccgt
gcaacttacgagtcggcaaccgatgatgaggcactggacgccttccagctactggctcgt
tgtgaaggaattattcctgcacttgagtcatcacacgccatcgcttatgcactcaagttt
gccgaaaaagccaccaaggaaaccatcttagtggtaaatctatcgggccgcggtgataaa
gatatcttcaccgttgcggatattctggaaaagcgcgagaaagcgcaactaacagcagat
aaggagagcggcgatgaccgaatctaa

DBGET integrated database retrieval system