KEGG   Shewanella violacea: SVI_2808Help
Entry
SVI_2808          CDS       T01206                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
svo  Shewanella violacea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SVI_2808 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SVI_2808 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SVI_2808 (trpA)
Enzymes [BR:svo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SVI_2808 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3182649..3183467
Genome map
AA seq 272 aa AA seqDB search
MTESKQAGRYQAAFAALKEKNQGAFVPFVTLGDPSPQLSLKIIDCLVENGADALELGFPF
SDPLADGPVIQAANLRSLAAGTTPTQCFEMLTEIRAKYPQLPIGLLLYANLVYANGIDTF
YAKAQAAGVDSVLIADVPVEEADPFIASAKAHGVAPIFIAPPNADRDTLKMVSEKGEGYT
YLLSRAGVTGTESKAGMPIGEILSRLKEFNGAPPLLGFGIAKPAQVKAAIEAGAAGIISG
SAVVKIIAANKDDETALLAKLGEFTRNMKAAT
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatctaaacaagcaggccgttaccaggcagcatttgccgcactaaaagaaaaa
aatcagggcgcgtttgtgccattcgtgactttaggcgatccaagcccacaactgtcactt
aagatcatcgactgtttagtcgaaaatggcgccgatgccctagagctaggttttcccttc
tctgatccactggccgatggccctgtcattcaagcagccaacctaagatcactggccgcg
ggcactacgccgactcagtgtttcgagatgctcaccgaaattcgagctaaatatccgcag
ctgcccatcggcctcttgctgtatgcaaaccttgtgtacgccaacggtatcgatactttt
tacgccaaggcccaggccgccggtgtggattcggtgcttattgccgatgtaccggtagag
gaagccgacccctttatcgcatcagccaaggctcatggtgttgcgcctatctttatcgca
ccgccaaatgccgatcgtgacaccctaaaaatggtgagcgagaaaggcgaaggctacact
tatttgctttcacgcgccggtgtcacaggcacagaatctaaggcgggtatgccaatcggt
gaaattttatctcgcctcaaagagtttaacggcgcgccgccattactcgggttcggtatt
gcaaagcctgcacaagttaaagccgccatagaagcaggcgctgccggtatcatctctggc
tcggcagtggtgaagatcattgccgctaataaagatgatgaaactgcattgctagctaag
ctgggcgagtttacccgcaacatgaaggccgctacctaa

DBGET integrated database retrieval system