KEGG   Shewanella violacea: SVI_2905Help
Entry
SVI_2905          CDS       T01206                                 

Gene name
fadB-2
Definition
fatty oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
svo  Shewanella violacea
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SVI_2905 (fadB-2)
   01212 Fatty acid metabolism
    SVI_2905 (fadB-2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SVI_2905 (fadB-2)
   00650 Butanoate metabolism
    SVI_2905 (fadB-2)
  Lipid metabolism
   00071 Fatty acid degradation
    SVI_2905 (fadB-2)
   01040 Biosynthesis of unsaturated fatty acids
    SVI_2905 (fadB-2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SVI_2905 (fadB-2)
   00310 Lysine degradation
    SVI_2905 (fadB-2)
   00380 Tryptophan metabolism
    SVI_2905 (fadB-2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SVI_2905 (fadB-2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SVI_2905 (fadB-2)
   00281 Geraniol degradation
    SVI_2905 (fadB-2)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SVI_2905 (fadB-2)
Enzymes [BR:svo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SVI_2905 (fadB-2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SVI_2905 (fadB-2)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SVI_2905 (fadB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3290328..3292454)
Genome map
AA seq 708 aa AA seqDB search
MEKTFNLVRREDGIAVLTIDVPGETMNTLRTEFAAEITEVLAEIKADTSIKGLVLASGKK
DCFVAGADISMLDACTSVEDAKALSQQGHIVFNELEALSIPVVAAIDGVCLGGGLELALA
CHLRVCSQNGKTMMGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKM
GLVDDVVPESILLATAVKMALKGKVAPKKENKSLVNKLLEGTAVGRNIIFDQAGKQVQKK
TQGNYPAPAKIIDCVRQGMAKGKTKGLEVEASHFAELVMSKESAALRSIFFATTEMKKET
GAGDVKPRKVNKAMILGGGLMGGGIASVTTSKAKIPARVKDISEQGLSNALSYAYKLLDK
GVKRRHMTPSARDNIMSLMTTTTEYIGIKYADIVVEAVFEDLSLKHQMVKDVERECGENT
IFASNTSSLPISQIAEAAARPENVIGLHYFSPVEKMPLVEVIAHKKTSPETIATTVAFAR
KQGKTPIVVQDGAGFYVNRILALYMNEAAQLLLEGQSVEHLDKALVKFGFPVGPMTLLDE
VGIDVGAKISPILEAELGERFKAPAAFDKLLSDGRKGRKNGKGFYLYAGKAKKKAKQVDE
SVYQVLGLKPGVNAEVSEVAQRCVVQMLNEAVRCLEEGIIASPRDGDIGAIFGIGFPPFL
GGPFHYIDTLGAGVLVAKLEKYQAKHGDRFTPCNKLIEMAESNQRFFD
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagacatttaatttagttcgtcgtgaagatggcatcgctgtactgacgatagat
gtacccggtgaaaccatgaatactctgcgcaccgagtttgctgccgagatcactgaggtt
ttggctgaaattaaagccgataccagtatcaagggactagttttagcttcaggtaagaaa
gattgtttcgttgccggtgcagatatttccatgttagatgcatgtacctcggtagaagat
gccaaggcactgtcacagcaagggcatattgtatttaacgaactcgaagccttatctatc
ccagttgtggcggcgatagatggcgtgtgtctgggcggcggtctggagctggcattggct
tgtcatctaagagtatgtagccaaaacggtaagaccatgatgggcgtgcctgaggttcag
ctaggcctgctacctggcggcggtggaacccaaaggttacctagactcgtgggtatcact
acggcgttagatatgatgctcacgggcaagcagatccgtcctaagcaagcgttgaagatg
ggcttggtcgacgatgttgtccccgagtcgatactgttagctaccgcagttaaaatggcg
ctgaaaggtaaagtagcgcctaagaaggagaataagtctctggttaacaagttactagaa
ggcacagctgttggccgcaatatcatcttcgatcaggcgggtaagcaagttcagaagaag
actcaaggtaattaccctgcacctgccaagattattgactgtgtgcgtcaaggcatggcg
aaggggaaaaccaagggactggaagtggaagccagccatttcgccgagctggttatgtcg
aaagagtcggccgcattaagaagcatcttctttgccacgaccgagatgaagaaagagacc
ggcgccggtgatgttaagcctcgcaaggttaacaaggctatgatactcggtggcggcctt
atgggcggcggtattgcctctgtgacgaccagtaaggctaagatcccggcgcgagtgaaa
gatatcagtgagcaggggcttagcaacgcactttcttatgcttataaactgctggataaa
ggtgtaaagcgtcgtcatatgacgccatcggccagagacaatatcatgtcgctgatgacc
acaaccactgagtatatcggcattaaatatgccgatatcgtggtagaggccgtttttgaa
gacttgagccttaagcatcagatggtaaaagatgtcgaacgcgagtgtggcgagaacacc
atttttgcatcaaatacctcttcactgcctatctcgcagattgctgaggctgctgctcgt
cctgaaaatgttatcggtctgcattacttttctccggttgagaagatgcccttggttgaa
gttatcgctcataagaaaacgtcgccagagaccatagcgactacggtagcctttgctcgc
aagcaaggtaaaacgcctattgttgtacaagatggtgctggcttttatgtgaatcgaatt
ttagcgctttacatgaatgaagctgcacaattgctgcttgaaggtcagagtgttgagcat
cttgacaaggcactggttaagtttggcttcccagttggtcctatgacactactcgatgaa
gttggaatcgatgtcggcgctaagatatcccctatattggaagctgagttaggcgagcga
tttaaggcgcctgctgcgtttgataagttgctgagcgatggcagaaagggtcgtaagaac
ggtaaaggcttctatctgtacgctggcaaggccaagaagaaagctaagcaagtcgacgag
agtgtctaccaagttctcggcttgaaacctggcgtgaacgcagaagtgtctgaagtcgcc
cagcgttgtgtggtgcagatgctcaatgaagctgtgcgttgtttggaagaggggattatc
gcctcaccacgtgatggtgatataggtgctatcttcggcattggtttcccgccattccta
ggtggaccattccattatattgatacgttaggagccggggttttagttgcaaaactagaa
aaataccaagccaagcacggtgacagatttacaccttgtaataagttgatagagatggct
gagagcaatcagcgtttcttcgactaa

DBGET integrated database retrieval system