KEGG   Shewanella violacea: SVI_2922Help
Entry
SVI_2922          CDS       T01206                                 

Definition
malate synthase domain-containing protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
svo  Shewanella violacea
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SVI_2922
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SVI_2922
   00630 Glyoxylate and dicarboxylate metabolism
    SVI_2922
Enzymes [BR:svo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SVI_2922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3310998..3311513)
Genome map
AA seq 171 aa AA seqDB search
MEISTISNECGEQNFTNLINAGIVNVKTSEAVTDIDTMANAKQFLDNTFPLAKGSHKEVC
SYVVYYQQLLMFFSDGSHTGLKDSGQFVALNGHKSEPEAILLNNNGTHVELSFDRGGKTG
NKDQAHIDDVRLEGHEYWISLLNVEEKRIIESSQTSQVFTAKDGSEYPLKG
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatctactatcagtaatgagtgcggcgagcagaactttacaaaccttatcaat
gccggaattgttaatgtaaaaacatcagaagccgttacagatattgacactatggccaat
gctaaacagtttcttgataacacatttccattagctaaaggttcccataaagaggtgtgc
agttacgtggtttactaccagcaactcttgatgtttttttccgacggaagccatacgggt
ctaaaggattcagggcaatttgtggcgttaaatggtcataagagtgaacctgaagctatc
ttgcttaataacaatggtacccatgtggaattgagtttcgatcgcggtggaaaaacgggt
aataaagaccaggctcacatagatgatgtcaggctagaaggtcatgaatactggattagc
ttgcttaatgttgaagagaagcgaatcattgaaagctcacaaacctcacaagtatttacg
gccaaagatggcagcgagtatccgcttaaaggctaa

DBGET integrated database retrieval system