KEGG   Shewanella violacea: SVI_3277Help
Entry
SVI_3277          CDS       T01206                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
svo  Shewanella violacea
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:svo00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3714033..3715364)
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNAEALSKEEIQFFVKGITDNTVSEGQIAAFGMAVYFNDMSMDERIALT
TCMRDSGTVLDWRSLDLNGPIIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPDSALFRKVVKEAGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLAAGLDALAMDVKVGSGAFMPTYEASEELARSITAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAVDFLTGKYRNPRLYEVTMGLCAEMLQLGGLAENEAQARDKL
NTVLDNGKAAEIFGRMISGLGGPTDFIENPGLYLPESNIVRPVYAEQAGFASAMDTRELG
MAVVTLGGGRRKPGDALDYSVGLTQVCALGDEITKDKPIAMIHAQSESAFEEASSAVRNA
IQVTETRSEKTPEIYRYIRAEDL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagcacaagagataattcgtaaaaaacgcaacgcagaagccttgtctaaagaa
gagatccagtttttcgtcaaaggcatcacagataataccgtttcagaaggccaaattgcg
gcctttggtatggcagtttacttcaacgacatgagcatggatgagcgtatcgcgctgacc
acatgtatgcgtgactctggcacagtactcgactggcggagtttggatcttaacggtcct
atcatagataagcacagtacgggtggcgtcggtgacgttatcagcttgatgcttggccca
atggctgccgcttgcggtggttatgtgccaatgatatcgggtcgtggtctgggtcatacc
ggcggtaccttagataagtttgatgccatcccaggttatcaaactgagccagatagcgcc
ctgttccgaaaagtggttaaagaggcgggtgtagccatcataggccaaaccggcgatctg
gttccagccgataagcgcttttactccattcgtgacaatactgccactgtcgagtcaatt
tcactgattaccgcttctatactgtccaagaaattggcagcaggtttagatgctctggct
atggacgtcaaagtaggtagtggtgcatttatgccgacctatgaagcatctgaagagtta
gcacgtagcattaccgcagtggctaacggtgctggaactaagacaactgcattacttaca
gacatgaatcaggtcttggcttcatgtgcgggtaatgccgtcgaggtgaaagaggcggtt
gatttccttacggggaaatatcgcaacccacgactttatgaagtcaccatgggcttatgt
gccgaaatgctgcaactcggtgggctagccgagaatgaagcgcaagcgagagataaactc
aataccgtgctcgataacggtaaagcggcagaaatttttggccgcatgatctcgggcctg
ggtggtccaacggactttatcgaaaatccaggtctgtatctgcccgagtctaatatagtt
cgtccggtttatgccgagcaagccggtttcgcatcggccatggatactcgagagctaggt
atggctgtggtcactttaggtggtggacgccgcaaacccggtgatgcactagattacagc
gtgggtctgactcaggtctgcgccttaggcgatgagatcactaaagataagcctattgcc
atgatccacgctcagtctgagagcgctttcgaagaagcgtcttcagcagttagaaatgca
attcaggtcactgagactcgttccgagaagacgcctgaaatttatcgttatatacgcgcc
gaagatctgtaa

DBGET integrated database retrieval system