KEGG   Shewanella violacea: SVI_3293Help
Entry
SVI_3293          CDS       T01206                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
svo  Shewanella violacea
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SVI_3293 (tpiA)
   01230 Biosynthesis of amino acids
    SVI_3293 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVI_3293 (tpiA)
   00051 Fructose and mannose metabolism
    SVI_3293 (tpiA)
   00562 Inositol phosphate metabolism
    SVI_3293 (tpiA)
Enzymes [BR:svo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SVI_3293 (tpiA)
Exosome [BR:svo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SVI_3293 (tpiA)
  Exosomal proteins of bladder cancer cells
   SVI_3293 (tpiA)
  Exosomal proteins of melanoma cells
   SVI_3293 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3735505..3736287)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAQLAQELFKKFSTKLQDDSAEVVLCPPTIYLESVRQQLDINKE
ALNGCLVRMGAQNLSQHDFGAYTGEVSGKMLKDSGCRYVIIGHSERRRMYGETSDIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIAKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGVSLNSTEFLSLCSIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagacgtccgatggttgctggtaactggaaaatgaatggtagtgctcaattg
gcacaagaactgtttaagaagttttctactaagctacaagatgattcagcggaagtggtt
ttatgtccaccgactatttatctagagagtgtacgacaacagttagacattaataaagaa
gccttaaatggttgtctagtcagaatgggcgcacaaaatctaagtcaacatgactttggt
gcttatactggtgaagtgtctggcaaaatgttgaaagattcaggatgtcgatatgtgatt
atcggccattccgaacgtcgccgtatgtacggagagacgagtgatatagtggcagagaag
tttgctgcggctcaaaaacatggtttgactccgatattatgtgtcggtgagtcaggtcca
gctagagaagcgagaagaacttttgaagttatcgccgaagagctagatatagtcattgca
aaaaatggcaccatggcttttgataatgcaattatcgcttacgagcctttatgggccgta
ggaactggtaagagtgctacgccagagcaggcgcaagaagttcatgcgtttatacgcaag
cgtctatctgaagtgtctccatttattggagaaaatatcaggattttgtacggtggtagc
gtaacaccgagtaatgcagcagatctttttgctcaacctgatgtagatggtggattgatt
ggcggcgtaagcttaaattcaaccgagtttttaagtttatgttccatagcgatgagcgca
taa

DBGET integrated database retrieval system