KEGG   Shewanella violacea: SVI_3710Help
Entry
SVI_3710          CDS       T01206                                 

Gene name
lacZ
Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
svo  Shewanella violacea
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:svo00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:svo00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4202841..4205936
Genome map
AA seq 1031 aa AA seqDB search
MAADRWQDHTIFEVNKEAPHASFFTYSSVSKATKDEYRNSSNFFDLNGIWQFHYAKNPQS
VPSDFASDSFDESGWSTIEVPGNWETQGYGHAIYLDERYPFTTTWPNAPTEHNPTGSYRR
VITLPENWNAKQVFFHVGAARSSFTLFVNGKEVGYSQGAKTPAEFDISDYLKAGKNLIAM
KIIRWSDASYLESQDMLRMSGIERDVYLYATEPQRVVDIDASYRLNGDLSRADMALKLKL
KNHHKEKQISLDYRVISPTGIDIAKGAKSLSLGGQKDELFNFTLKHPQLWSAETPNLYQL
IVNLRDLDGALLQSSSQKIGFRHIEIKGGQLLVNNKAITIRGVDRHETDPKTGHVVSRES
MEKDIRLMKQSNINAVRSSHYPNDPYWLRLADRYGMYIIDEANIESHPLAIDEKTQLGNE
MSWLPAHQARVERMLERDKNHASIIIWSLGNEAGEGKLFESLYHWVKQRDPSRPVQYEPA
GTQAYTDIVAPMYPSIERIEKYAKNHSDRPLIMIEYAHAMGNSVGNLQDYWDVIEQYPNL
QGGFIWDWADQSLAFTNDKGQRYWAYGKDYEPDMPTDGNFLNNGLVDPDRNPHPHLSQVK
KVYQPIGFDNFRIDGARVSLNLSNKYDFKNTAGLELNWSLQQDGLSIHTGQMKMPVIPAG
KSQTVDFQLGSEQALKLNKHYDYHLLVTARIDSPQPMLPSGHRLAFEQFEIQQASPRISK
ISHTSKISQTPDLWLLSLNENSYAISKDTGWLTRVTTGGEPQISAPLMVNFWRAPTDNDL
GNGLPEWGGIWQDAASELELESIDKVNNKGLMVTQVHPKLGFSLSTLYQLNTKGELVVNS
QFEPGNKDLADLPRFGFSTRLPFDRRFMSYFGRGPEETYADRYTGNPLGWYQLPIEKLYH
RYSRPQETGQRTQVRYAAVTNHAGSGLMAIAAKELQTSLWPFSQTDIDFRSGDAQSSASG
LVPVTRNHGAEIPIRDYVTWNIDYKQMGVGGDTSWGRQVHEPYRIKAQPMSFEFTLVPID
SSSQLQQLARD
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
ttggctgccgatcgttggcaagaccacaccatctttgaagtgaataaagaagccccccac
gccagcttttttacttacagctcggtcagcaaggccactaaagatgagtaccgtaacagt
agcaactttttcgatctcaacgggatctggcaatttcattacgccaagaatcctcaatct
gtgccatctgactttgccagcgactccttcgatgagtcaggctggagcaccattgaagtt
cccggcaactgggaaacacaaggctacggccatgccatctacctagatgaacgctatccc
ttcactacgacctggccaaatgcgccaaccgaacataaccccactggcagctaccgacgc
gtgatcaccttgcccgaaaactggaatgccaagcaggtcttcttccatgttggggcggcg
cgatcttccttcaccttgttcgtcaacggcaaggaagtgggctatagccaaggcgccaag
acccctgcagaatttgatatctctgattatttgaaagcgggtaagaatctgatcgccatg
aagatcatccgctggagcgatgccagttatcttgaaagccaagatatgctgcgtatgagt
ggcatagagagagatgtgtatctttacgccactgagccacagagagttgtcgatatcgat
gcaagttataggctcaacggcgatcttagtcgcgccgatatggcacttaaactcaagctc
aagaaccatcataaagagaagcagatatccctagattaccgagtcatctcccccactggc
attgatatcgctaaaggggctaaatcactcagtttaggcgggcagaaagatgagctgttc
aatttcaccctcaagcatccccaactgtggagcgccgagacaccaaacctgtatcagctt
atcgtcaacctaagagacctagatggagcattactccaatccagtagtcagaagataggc
tttcgccatatagagataaaaggcggccagctactggtgaacaacaaggccatcacaata
cgcggtgtcgaccgccacgaaacagatcccaaaactggtcatgtggtcagccgtgagagt
atggaaaaagacatacgcttgatgaagcaaagcaatatcaacgccgtgcgctcgagtcac
tatcctaacgatccctactggctacgactcgccgacagatatggcatgtatattatcgac
gaagccaatattgaatcccatccactggcaatcgacgagaagactcagctcggcaacgag
atgagctggctgccagcccaccaagctagggtcgagcgtatgctagagcgggacaagaat
catgcctctatcatcatctggtcattgggcaacgaggctggggaaggcaagttattcgaa
tctctttaccactgggtaaaacagcgagatcccagtcgtccggtccaatatgaaccggca
ggcacacaagcttataccgacatagtcgcgcccatgtatccgtccatagaacgcatagaa
aagtatgctaagaatcattctgatcgcccactaatcatgatcgaatatgcccatgccatg
ggcaattctgtgggtaatttgcaagactattgggatgtcatcgagcagtaccctaacctg
caaggtggctttatctgggactgggccgatcaatctctggccttcaccaatgataaaggc
caaagatattgggcctacggcaaggactatgagccagatatgcctaccgacggcaacttc
ctcaataatggcctggttgatcccgaccgcaaccctcatccacacctgagccaagtaaag
aaggtatatcagcctattggattcgataattttcgaatagatggcgccagggtaagcttg
aacctgagtaacaaatacgactttaagaacacagcgggtctggagctaaattggtcattg
caacaagatggactatcaatccacaccggccagatgaagatgccggtaattccagccgga
aagagtcaaactgtcgacttccagctcggatctgagcaagcactaaagcttaataaacac
tacgactatcatctactcgtcaccgcacgaatcgattcaccacaacccatgttgccctcg
ggtcacagactggccttcgagcaatttgagatccagcaggcttcacccaggataagcaag
ataagccacaccagcaaaattagccaaaccccagacctatggctcttgagtctcaatgaa
aatagctacgccatctctaaagataccggctggttaacccgagtcaccacaggtggagag
cctcagataagcgcccccctaatggtcaatttctggcgagcaccaacagataatgatctc
ggtaatggcctgcctgaatggggcggaatttggcaagatgcagcatctgagcttgaactc
gagtccatcgataaggttaacaataaaggccttatggtcacccaagtccatcccaaactc
ggctttagcctgagcaccctctaccagctcaatactaagggagagctagtggttaacagc
caatttgagccgggtaataaggatttagcggatctacccaggtttggctttagcactcgc
ttgcccttcgaccgacgattcatgagttacttcggccgcggtcctgaagaaacttacgcc
gaccgatacacaggcaacccacttggttggtatcaactgcctatcgaaaagttatatcac
cgctactcacgtccacaggaaacaggccagcgaactcaggttcgatacgcagccgtaact
aatcatgcaggaagcggcctgatggccatcgccgctaaagagttacaaaccagcctatgg
cccttctctcagaccgatatcgactttagaagcggtgatgctcaaagctcggcttcaggc
ttagtacctgtgacccgaaatcatggcgccgaaatccccattcgggattatgtgacctgg
aatatcgattacaaacagatgggtgtaggcggagatacctcatggggcagacaagtccat
gaaccctatcgtatcaaggcccagcccatgagtttcgaatttactcttgtgcccatcgac
tcgagtagccaactccagcagctggccagagactag

DBGET integrated database retrieval system