KEGG   Shewanella violacea: SVI_3811Help
Entry
SVI_3811          CDS       T01206                                 

Gene name
tatC
Definition
Sec-independent periplasmic protein translocation protein TatC
Orthology
K03118  
sec-independent protein translocase protein TatC
Organism
svo  Shewanella violacea
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Brite
KEGG Orthology (KO) [BR:svo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    SVI_3811 (tatC)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    SVI_3811 (tatC)
Secretion system [BR:svo02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein [MD:M00336]
   SVI_3811 (tatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4318312..4319061
Genome map
AA seq 249 aa AA seqDB search
MSQQQPLISHLLELRTRLLHAITSVVLVFACMAYWSNDIYHYMATPLMQALPESSSMIAT
DVAAPFFAPFKLTLVLSFFIAIPYVLYQIWSFIAPGLYKHEKRLMIPLLASSTILFYLGI
AFSYYVVFPVVFGFFANVAPEGVQVATDISSYLSFVLKLFFAFGLAFEIPIAVILLCWAG
VTTPDELKAKRPYIVVGAFVIGMLLTPPDIISQTMLAVPMLILFEGGLIAARFYSKKDTE
EDDEQEKQD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaacagcagcctcttatcagtcatctactcgagctacgcacgcgtttgcttcat
gctatcaccagtgtggtcttagtttttgcttgtatggcctattggtccaatgatatttac
cattatatggcaacgcctctgatgcaggctctgcctgaatcaagcagcatgattgcaaca
gatgtggcggcgcccttctttgccccatttaagctgactctggtgttatctttcttcatc
gccatcccctatgtcttgtatcagatctggtcatttatcgcaccaggcttgtataaacat
gagaagcgtttgatgatacctttgctagccagtagcaccatcttgttttacctaggaatt
gccttctcctactatgtcgtttttcctgtcgtatttggatttttcgccaatgtggctccg
gaaggtgtccaagttgctacggatatcagcagctatctgagcttcgtgcttaaacttttc
ttcgccttcggtttagccttcgagatccccattgctgtaattttactctgttgggccggt
gtgacgaccccagatgagctcaaagctaaacgtccttatatcgttgttggcgccttcgtt
ataggcatgctgctgacaccaccagacatcatttctcagactatgttggcagttcctatg
ctgatattattcgaagggggattgattgctgcacgtttctacagtaaaaaggatactgaa
gaagacgatgagcaagagaaacaggattaa

DBGET integrated database retrieval system