KEGG   Shewanella violacea: SVI_3811Help
Entry
SVI_3811          CDS       T01206                                 

Gene name
tatC
Definition
Sec-independent periplasmic protein translocation protein TatC
Orthology
K03118  
sec-independent protein translocase protein TatC
Organism
svo  Shewanella violacea
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:svo03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:svo03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4318312..4319061
Genome map
AA seq 249 aa AA seqDB search
MSQQQPLISHLLELRTRLLHAITSVVLVFACMAYWSNDIYHYMATPLMQALPESSSMIAT
DVAAPFFAPFKLTLVLSFFIAIPYVLYQIWSFIAPGLYKHEKRLMIPLLASSTILFYLGI
AFSYYVVFPVVFGFFANVAPEGVQVATDISSYLSFVLKLFFAFGLAFEIPIAVILLCWAG
VTTPDELKAKRPYIVVGAFVIGMLLTPPDIISQTMLAVPMLILFEGGLIAARFYSKKDTE
EDDEQEKQD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaacagcagcctcttatcagtcatctactcgagctacgcacgcgtttgcttcat
gctatcaccagtgtggtcttagtttttgcttgtatggcctattggtccaatgatatttac
cattatatggcaacgcctctgatgcaggctctgcctgaatcaagcagcatgattgcaaca
gatgtggcggcgcccttctttgccccatttaagctgactctggtgttatctttcttcatc
gccatcccctatgtcttgtatcagatctggtcatttatcgcaccaggcttgtataaacat
gagaagcgtttgatgatacctttgctagccagtagcaccatcttgttttacctaggaatt
gccttctcctactatgtcgtttttcctgtcgtatttggatttttcgccaatgtggctccg
gaaggtgtccaagttgctacggatatcagcagctatctgagcttcgtgcttaaacttttc
ttcgccttcggtttagccttcgagatccccattgctgtaattttactctgttgggccggt
gtgacgaccccagatgagctcaaagctaaacgtccttatatcgttgttggcgccttcgtt
ataggcatgctgctgacaccaccagacatcatttctcagactatgttggcagttcctatg
ctgatattattcgaagggggattgattgctgcacgtttctacagtaaaaaggatactgaa
gaagacgatgagcaagagaaacaggattaa

DBGET integrated database retrieval system